Biochemicals and Reagents

Peptide H-ENAGEDPGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ENAGEDPGLAR^-OH include the following: Dermcidin identification from exhaled air for lung cancer diagnosis WC Chang, MS Huang, CJ Yang - European , 2010 - Eur Respiratory Sochttps://erj.ersjournals.com/content/35/5/1182.short Exogenous proteins in exhaled human breath condensate VS Kurova, AS Kononikhin , DA Sakharov - Russian journal of , 2011 - Springerhttps://link.springer.com/article/10.1134/S1068162011010110 A rare loss-of-function genetic mutation suggest a role of dermcidin deficiency in hidradenitis suppurativa pathogenesis PM Tricarico , R Gratton, CA Santos-Silva - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2022.1060547/full Egyetemi doktori (PhD) ertekezes tezisei MSaca‰SID ISKOLA - dea.lib.unideb.huhttps://dea.lib.unideb.hu/bitstreams/bd058c28-a2bf-47d1-b8ac-a8e65fa0f702/download Reduced level of tear antimicrobial and immunomodulatory proteins as a possible reason for higher ocular infections in diabetic patients G Kallo , AK Varga, J Szabo, M Emri , J TÅ‘zser , A Csutak - Pathogens, 2021 - mdpi.comhttps://www.mdpi.com/2076-0817/10/7/883 THESIS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY (PHD) G Kallo - dea.lib.unideb.huhttps://dea.lib.unideb.hu/bitstreams/b159686e-fcbd-48df-b0f2-e2328ad19e8d/download Dermcidin: a skeletal muscle myokine modulating cardiomyocyte survival and infarct size after coronary artery ligation G Esposito , GG Schiattarella , C Perrino - Cardiovascular , 2015 - academic.oup.comhttps://academic.oup.com/cardiovascres/article-abstract/107/4/431/311510 Mass spectrometry for high-throughput proteome analysis and biomarker discovery CH Chen - Hiroshima Conference on Education and Science in - hiroshima-u.ac.jphttps://www.hiroshima-u.ac.jp/system/files/58163/5thHC_Proceedings.pdf#page=69 Exhaled breath condensate analysis from intubated newborns by nano-HPLC coupled to high resolution MS AS Kononikhin , NL Starodubtseva - of Chromatography B, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023216314696 Highly abundant defense proteins in human sweat as revealed by targeted proteomics and label-free quantification mass spectrometry aca‰ CsÅ‘sz , G Emri , G Kallo , G Tsaprailis - Journal of the , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/jdv.13221 Detection of antimicrobial peptides in stratum corneum by mass spectrometry A Jenei , G Kallo , Z Dajnoki , K Gaspar - International Journal of , 2021 - mdpi.comhttps://www.mdpi.com/1422-0067/22/8/4233

Minoxidil

H-FVQWFVGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FVQWFVGL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FVQWFVGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FVQWFVGL-OH at the technical inquiry form on this page

Peptide H-CTFEHWWSQLLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CTFEHWWSQLLS-OH include the following: Tethered ribozyme ligation enables detection of molecular proximity in homogeneous solutions B Katzman, M Vyazmensky, O Press - Biotechnology , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/biot.201400551

2-(4-Bromophenyl)-2,3-dihydro-1H-perimidine is a research tool that can be used as an activator or a ligand. It has been shown to inhibit the activity of ion channels and may be useful in pharmacology. 2-(4-Bromophenyl)-2,3-dihydro-1H-perimidine binds to an antibody and causes it to bind to a receptor on the cell surface. This ligand is able to activate the receptor by binding to it and triggering a signal transduction pathway inside the cell. 2-(4-Bromophenyl)-2,3-dihydro-1H-perimidine is also able to inhibit protein interactions with peptides.

Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.

PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM

Anti-Human LAG3 Monoclonal Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TCP11L2 antibody, catalog no. 70R-3467

Peptide H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2 include the following: Increased beta-haemolytic group A streptococcal M6 serotype and streptodornase B-specific cellular immune responses in Swedish narcolepsy cases A Ambati , T Poiret , BM Svahn - Journal of internal , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/joim.12355

Rabbit polyclonal C3AR1 antibody

Please enquire for more information about Cytokeratin (pan) basic type 2 Ab including the price, delivery time and more detailed product information at the technical inquiry form on this page

CC-115 is a small molecule that inhibits transcriptional regulation. It binds ATP-binding cassette transporters and blocks the export of fatty acids from the cell, which leads to increased levels of intracellular fatty acids and autophagy. CC-115 has shown efficacy in prostate cancer treatment, as well as squamous carcinoma. This drug has a potent inhibitory effect on gene expression and is currently undergoing clinical trials for use in high-risk disease.

Z-Leu-Leu-Leu-H (aldehyde) is an inhibitor that binds to a receptor and prevents the binding of a ligand. This competitive inhibition is reversible and can be used as a research tool to study protein interactions. The high purity of this product makes it ideal for use in pharmacology, cell biology, and life science research.

Region of Eotaxin 2 protein corresponding to amino acids VTIPSSCCTS FISKKIPENR VVSYQLANGS ICPKAGVIFI TKKGHKICTD PKLLWVQRHI QKLDAKKNQP SKGAKAVRTK FAVQRRRGNS TEV.

Fusidic acid sodium salt

Mouse Anti Mullerian Hormone antibody

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Biotin antibody was raised in goat using biotin conjugated to KLH as the immunogen.

Mouse monoclonal ID3 antibody

Rabbit polyclonal TRIP6 antibody

Purified Polyclonal IFNGR1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of NKD1 antibody, catalog no. 70R-3079

PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Recombinant Human KIAA0513 protein (His tag)

Mouse monoclonal SOCS3 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Rifapentine, the active form of this drug, undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, Rifapentine specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its potent antituberculosis properties and broad range of actions

A synthetic peptide for use as a blocking control in assays to test for specificity of SH3GL2 antibody, catalog no. 70R-5257

AP C5 is an antimicrobial peptide, which is a biologically-derived molecule with potent bactericidal properties. It originates from natural or synthetic sources, often designed to mimic peptides found in diverse organisms such as amphibians, insects, or mammals that possess innate immune responses. The mode of action of AP C5 involves interaction with microbial membranes, where it binds to and disrupts the integrity of the lipid bilayer. This disruption leads to cell lysis or apoptosis, effectively neutralizing pathogenic bacteria and other microbes. Unlike conventional antibiotics, the efficacy of AP C5 is primarily attributed to its capacity to target and compromise microbial cell membranes rather than specific internal targets, which reduces the likelihood of resistance development. AP C5 finds its applications in clinical and research settings where there is a need for effective antimicrobial activity, particularly in combating antibiotic-resistant strains. Its versatility and specificity make it a valuable tool in the development of new therapeutic strategies, biofilm inhibition, and as a potential additive in materials to prevent microbial contamination. Its utility extends to various fields including microbiology, medicine, and biotechnology research, providing innovative solutions to persistent microbial challenges.

Recombinant Human CSK protein

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC27A4 antibody, catalog no. 70R-7204

CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen

C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Antimycin A

Mouse Monoclonal NUDT1 antibody

LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG

Purified Rabbit polyclonal TUBGCP3 antibody

Mouse monoclonal STAT3 antibody

Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RFVFG^T^TPEDILR-OH include the following: N-Terminomics identifies HtrA1 cleavage of thrombospondin-1 with generation of a proangiogenic fragment in the polarized retinal pigment epithelial cell C Chen, E Melo, P Jakob, A Friedlein, B Elsasser - Matrix Biology, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0945053X17304857

A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT5 antibody, catalog no. 70R-5820

GluN2C/GluN2D-selective antagonist of NMDA glutamate receptor

CD45 antibody (Azide free) was raised in Rat using CD45/LCA as the immunogen.

OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

A synthetic peptide for use as a blocking control in assays to test for specificity of NPDC1 antibody, catalog no. 70R-1900

RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY

Peptide H-LVLEVAQHLGESTVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LVLEVAQHLGESTVR-OH include the following: Mass Spectrometry-Based Methods to Investigate Posttranslational Protein Modifications by Lipid Peroxidation Products N Rauniyar, L Prokai - Mass Spectrometry Handbook, 2012 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=S6r8geKvKM8C&oi=fnd&pg=PA23&dq=(%22H-LVLEVAQHLGESTVR-OH%22+OR+%22LVLEVAQHLGESTVR%22)+AND+peptide&ots=q_EBAl7e2D&sig=32PJblL2DZZ8f3MBnWFX6983V_I Mass Spectrometry-Based Methods to Investigate Posttranslational Protein Modifications by Lipid Peroxidation Products N Rauniyar, L Prokai - Mass Spectrometry Handbook, 2012 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=S6r8geKvKM8C&oi=fnd&pg=PA23&dq=(%22H-LVLEVAQHLGESTVR-OH%22+OR+%22LVLEVAQHLGESTVR%22)+AND+peptide&ots=q_EBAl7fYE&sig=bsXKtkB4JDcb9M2WMNgQEig_Vws Characterization of 4-hydroxy-2-nonenal-modified peptides by liquid chromatography-tandem mass spectrometry using data-dependent acquisition: Neutral loss N Rauniyar , SM Stevens Jr , K Prokai-Tatrai - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac802015m Isotope-coded dimethyl tagging for differential quantification of posttranslational protein carbonylation by 4-hydroxy-2-nonenal, an end-product of lipid peroxidation N Rauniyar , L Prokai - Journal of mass spectrometry, 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1978 Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria J Guo, K Prokai-Tatrai , V Nguyen , N Rauniyar - Journal of , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391911003289 The use of chemical probes to detect the proteomics of renal tubular injury induced by maleic acid HYH Lin , CJ Liang, MC Liu, MF Huang - of Chromatography A, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967318307969

Peptide H-GDVTTQVALQPALK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GDVTTQVALQPALK^-OH include the following: Processing of data generated by 2-dimensional gel electrophoresis for statistical analysis: missing data, normalization, and statistics J Chang, HV Remmen , WF Ward - Journal of Proteome , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr049886m Diminished superoxide generation is associated with respiratory chain dysfunction and changes in the mitochondrial proteome of sensory neurons from diabetic rats E Akude, E Zherebitskaya, SKR Chowdhury - Diabetes, 2011 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/60/1/288/15317

C18ORF10 antibody was raised using the middle region of C18Orf10 corresponding to a region with amino acids LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPIT

Purified recombinant CDKN2AIPNL protein (His tag)

2-Hydroxy-4-methylvaleric acid is used as nutrients, stabilizers, surfactants and emulsifiers. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Peptide H-ALIVFWKYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALIVFWKYR-OH include the following: Natural high-avidity T-cell receptor efficiently mediates regression of cancer/testis antigen 83 positive common solid cancers Q Li, W Hu, B Liao, C Song, L Li - Journal for Immunotherapy of ..., 2022 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC9263944/

Peptide pE-VHHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using pE-VHHQK-OH include the following: Genetic and expressional studies of Alzheimer's disease candidate genes, Emphasis on CYP19, seladin-1 and HSPG2 genes (Alzheimerin taudille altistavien S Iivonen - 2005 - erepo.uef.fihttps://erepo.uef.fi/bitstream/handle/123456789/9349/urn_isbn_951-27-0207-X.pdf?sequence=1 Binding Sites of a Positron Emission Tomography Imaging Agent in Alzheimer's beta-Amyloid Fibrils Studied Using 19F Solid-State NMR P Duan , KJ Chen , G Wijegunawardena - Journal of the , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.1c12056 Abeta5-x Peptides: N-Terminal Truncation Yields Tunable Cu(II) Complexes NE Wezynfeld , A Tobolska, M Mital - Inorganic , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.inorgchem.0c01773 Porcine APP cDNAs: Molecular cloning and characterization, expression analysis, chromosomal localization and SNP analysis MA Oerum, C Bendixen, LB Madsen - Biochimica et Biophysica , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0167478106000947 Amyloidogenic properties of the prion protein fragment PrP (185-208): Comparison with Alzheimer's peptide Abeta (1-28), influence of heparin and cell toxicity M Cortijo-Arellano, J Ponce, N Durany - and biophysical research , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X08000892 Tramiprosate, a drug of potential interest for the treatment of Alzheimer's disease, promotes an abnormal aggregation of tau I Santa-Maria , F Hernandez , J Del Rio - Molecular , 2007 - Springerhttps://link.springer.com/article/10.1186/1750-1326-2-17 Fiber diffraction as a screen for amyloid inhibitors DA Kirschner , AAR Gross, MM Hidalgo - Current Alzheimer , 2008 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/car/2008/00000005/00000003/art00006 Introduction to Alzheimer's disease D Allsop - Alzheimer's Disease: Methods and protocols, 2000 - Springerhttps://link.springer.com/protocol/10.1385/1-59259-195-7:1 A Possible Candidate for the Fight against Alzheimer's Disease A Mukadam, K Bourne, WP Tate - Chemistry in New Zealand, 2009 - researchgate.nethttps://www.researchgate.net/profile/Warren-Tate/publication/266332456_A_Possible_Candidate_for_the_Fight_against_Alzheimer%27s_Disease/links/5768bd6508aef6cdf9b40b60/A-Possible-Candidate-for-the-Fight-against-Alzheimers-Disease.pdf

H-CGGLKLVRPKALLDNS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGLKLVRPKALLDNS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGLKLVRPKALLDNS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGLKLVRPKALLDNS-OH at the technical inquiry form on this page

Rabbit polyclonal EFNB1 antibody

Repotrectinib is an inhibitor of the enzyme c-Met, which is a receptor tyrosine kinase that is involved in various cellular processes. It has been shown to have potent antitumor activity against many solid tumor cell lines and murine xenografts. Repotrectinib inhibits cancer cells by binding to the c-Met receptor and preventing it from initiating downstream signaling pathways. The drug also has a low expression in normal tissues, which limits its toxicity. Repotrectinib's mechanism of action is through inhibition of the protein secretase, which prevents the conversion of pro-caspase-1 into active caspase-1. Caspase-1 has been shown to be essential for apoptosis induction in cancer cells.

Nanatinostat is a histone deacetylase inhibitor that selectively inhibits HDAC1 and HDAC2. It has been shown to be effective in the treatment of bladder cancer cells and chronic viral infections, but not in clinical development for other cancers. Nanatinostat inhibits the aminopeptidase activity of HDACs and prevents the removal of lysine residues from histones. This causes an increase in acetylation of nucleosomal histones, which results in transcriptional activation of genes that are associated with tumor suppression and apoptosis. Nanatinostat also modifies the fatty acid composition of cellular membranes by inhibiting fatty acid synthase, thereby causing lipid peroxidation-induced apoptosis.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Antipain is a proteolytic enzyme that hydrolyzes peptide bonds in proteins. It is a member of the papain family of proteases and has been shown to activate peptides and inhibit ion channels, both of which are important for cell biology research. Antipain, an inhibitor of protein synthesis, is also used as a research tool in cell biology and biochemistry.

A synthetic peptide for use as a blocking control in assays to test for specificity of TAAR5 antibody, catalog no. 70R-9832

ZFP28 antibody was raised in rabbit using the middle region of ZFP28 as the immunogen

ZLDI-8 is a prognostic marker that can be used to predict the response of a patient with non-small-cell lung cancer to chemotherapy. The assay detects the presence of ZLDI-8 protein in cell culture, and can be used to predict the response of a patient with non-small-cell lung cancer to chemotherapy. The level of ZLDI-8 protein in cells is not affected by etoposide treatment, indicating that it is not an oncogene. ZLDI-8 expression is correlated with tumor progression and has been shown to be involved in epithelial mesenchymal transition (EMT). This protein also has potential as an antitumor agent due to its ability to inhibit tumor growth and induce apoptosis through inhibition of angiogenesis, proliferation, and invasion.

H-YFAWEPSFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YFAWEPSFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YFAWEPSFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YFAWEPSFR-OH at the technical inquiry form on this page

The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.

Native Canine Adenovirus Type 1 antigen

Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DPIYFTGLASEPGAR^-OH include the following: The membrane protein sortilin can be targeted to inhibit pancreatic cancer cell invasion F Gao, N Griffin , S Faulkner, X Li , SJ King - The American journal of , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002944020302893

The TMOD1 antibody is a highly specific monoclonal antibody that targets the glycoprotein TMOD1. This antibody has been shown to neutralize the superoxide produced by TMOD1 dimers, making it an essential tool for researchers studying the role of TMOD1 in various biological processes. The TMOD1 antibody can be used in a wide range of applications, including immunofluorescence, western blotting, and ELISA. It has also been used to study the effects of TMOD1 on interferon signaling and the development of autoimmune diseases. With its high specificity and cytotoxic properties, the TMOD1 antibody is a valuable tool for researchers in the Life Sciences field.

Catalogue peptide; min. 95% purity

UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

CRTR1 antibody was raised in rabbit using residues 1-16 MLFWHTQPEHYNQHNS and 464-479 TLKAESSDGYHIILKC of the CRTR-1 protein as the immunogen.

Purified Rabbit polyclonal ATF2 antibody (Thr69or51)

Peptide H-ATLTVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ATLTVDK-OH include the following: Design, production, and characterization of a single-chain variable fragment (ScFv) derived from the prostate specific membrane antigen (PSMA) monoclonal antibody SA Parker, ILC Diaz, KA Anderson, CA Batt - Protein expression and , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592813000454

KIR2DL1 antibody was raised in mouse using recombinant human kIR2DL1 (23-223 aa) purified from E. coli as the immunogen.

Exendin-3 (9-39) is a potent and selective GLP-1 receptor antagonist. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Rabbit polyclonal MYB27 antibody

Ulifloxacin-d8 is a medicinal compound that has been developed as an anticancer agent. It is an analog of Ulifloxacin, which is a potent kinase inhibitor that has shown promise in the treatment of cancer. Ulifloxacin-d8 has been shown to inhibit the activity of protein kinases, which are enzymes that play a key role in regulating cell growth and division. This inhibition leads to apoptosis, or programmed cell death, in cancer cells. Ulifloxacin-d8 has also been detected in human urine samples and may have potential as a diagnostic tool for cancer detection. Its effectiveness against various types of tumors makes it a promising candidate for further research and development in the field of oncology.

Rabbit polyclonal Rho antibody

Purified Polyclonal ZO3 antibody

Mouse monoclonal HPGD antibody

TENOVIN-5 is a peptide inhibitor of the P2X7 receptor. It is a high purity, stable, and water insoluble compound that can be used as a research tool to study protein interactions, ligand binding and activation of the P2X7 receptor. TENOVIN-5 has been shown to bind to the extracellular domain of the P2X7 receptor and inhibit its function. TENOVIN-5 also activates the P2Y1 receptor in a dose-dependent manner.

Rabbit polyclonal ALK antibody (Tyr1604)

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit polyclonal ANXA10 antibody