Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of LIN9 antibody, catalog no. 70R-9005

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

SNRPD2 antibody was raised using the middle region of SNRPD2 corresponding to a region with amino acids ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG

Purified recombinant Human EPCAM protein (His tag)

Humanized IgG1 monoclonal antibody targeting aggregated α-synuclein; motor function

A synthetic peptide for use as a blocking control in assays to test for specificity of GART antibody, catalog no. 70R-4053

Purified recombinant UTP23 protein (His tag)

H-AGYAILKCNDKNFNG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AGYAILKCNDKNFNG-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AGYAILKCNDKNFNG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AGYAILKCNDKNFNG-OH at the technical inquiry form on this page

PCR Mycoplasma Test Kit II

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT3 antibody, catalog no. 70R-6596

Rabbit polyclonal TAF1L antibody

The PTPN4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the PTPN4 protein, which plays a crucial role in cell signaling pathways and growth factor regulation. This multispecific antibody has been extensively tested in vitro experiments and has shown high affinity and specificity for its target. One of the key applications of the PTPN4 antibody is its use as a methyltransferase inhibitor. By blocking the activity of this enzyme, it can modulate epigenetic modifications and gene expression, providing valuable insights into cellular processes and potential therapeutic interventions. In addition to its role as a methyltransferase inhibitor, the PTPN4 antibody also acts as an anti-icos antibody. It binds to cell death ligands and inhibits their interaction with their receptors, thereby preventing programmed cell death. This property makes it a valuable tool for studying immune responses and investigating novel approaches for immunotherapy. Whether you are conducting basic research or

Please enquire for more information about Recombinant EBV Early Antigen p138 including the price, delivery time and more detailed product information at the technical inquiry form on this page

trans-Resveratrol 4'-O-?-D-glucopyranoside

Human IgG Fc Fragment (FITC)

H-LDVVKRQQELLRLTV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LDVVKRQQELLRLTV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LDVVKRQQELLRLTV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LDVVKRQQELLRLTV-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of NKX6-3 antibody, catalog no. 20R-1236

Purified Recombinant AFP protein (His tagged)

Rabbit polyclonal CD19 antibody

Rabbit polyclonal PPIA antibody

Catalogue peptide; min. 95% purity

Custom research peptide; min purity 95%.

Catalogue peptide; min. 95% purity

Rabbit anti-dog IgG (Alk Phos) was raised in rabbit using canine IgG F(c) fragment as the immunogen.

Mouse monoclonal PTPN11 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FICD antibody, catalog no. 70R-5702

Rabbit polyclonal PAICS antibody

Farnesoid X receptor agonist

NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP

Mouse monoclonal SulT1C2 antibody

Purified Polyclonal Cytokine IK antibody

ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW

A synthetic peptide for use as a blocking control in assays to test for specificity of TM4SF20 antibody, catalog no. 70R-6760

Stability Hygroscopic Applications 5-Methylcytidine is a derivative of Cytidine (C998300), found in ribonucleic acids of animals, plants and bacteria. 5-Methylcytidine is a nucleoside found in liver emulsion that can inhibit the growth of spontaneous tumors of mammary gland origin in mice. 5-Methylcytidine is one of many nucleosides that can be used as biomedical marker using liquid chromatography and ion trap mass spectrometry coupling. References Kammerer, B., et al.: Anal. Biol. Chem., 382, 1017 (2005); Strong, L. and Matsunaga, H.: J. Surg. Oncol., 4, 528 (1972)

CASP10 antibody was raised in rabbit using the middle region of CASP10 as the immunogen

CDDO-3P-IM is a high purity, potent and selective activator of the TRPA1 ion channel. CDDO-3P-IM is a peptide that acts as an agonist at TRPA1 by binding to the extracellular domain of TRPA1. It has been shown to be a powerful inhibitor of protein interactions and to have a high affinity for receptor binding. This compound is also used as a research tool in cell biology and pharmacology experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of IL11RA antibody, catalog no. 70R-7223

Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 include the following: RVG29 Peptide-Modified Exosomes Loaded with Mir-133b Mediate the RhoA-ROCK Pathway to Improve Motor and Neurological Symptoms in Parkinson's Disease P Jiang, Y Xiao, X Hu, C Wang, H Gao- ACS Biomaterials ..., 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsbiomaterials.3c01622 Peptide-enabled targeted delivery systems for therapeutic applications M Liu, X Fang, Y Yang, C Wang - Frontiers in bioengineering and ..., 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fbioe.2021.701504/full Engineering mesenchymal stromal/stem cell-derived extracellular vesicles with improved targeting and therapeutic efficiency for the treatment of central nervous AM Iavorovschi, A Wang - Neural regeneration research, 2020 - journals.lww.comhttps://journals.lww.com/nrronline/fulltext/2020/15120/Engineering_mesenchymal_stromal_stem_cell_derived.7.aspx RVG-modified exosomes derived from mesenchymal stem cells rescue memory deficits by regulating inflammatory responses in a mouse model of Alzheimer's G Cui, H Guo, H Li, Y Zhai, Z Gong, J Wu, J Liu- Immunity & ..., 2019 - Springerhttps://link.springer.com/article/10.1186/s12979-019-0150-2 Exploiting exosomes in cancer liquid biopsies and drug delivery CA Fitts, N Ji , Y Li , C Tan - Advanced healthcare materials, 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adhm.201801268 Enhanced delivery of Mycobacterium tuberculosis antigens to antigen presenting cells using RVG peptide O Garnica, K Das , S Devasundaram - Tuberculosis, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1472979219301489 Engineered exosomes with ischemic myocardium-targeting peptide for targeted therapy in myocardial infarction X Wang, Y Chen, Z Zhao, Q Meng, Y Yu- Journal of the ..., 2018 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/JAHA.118.008737

N-Palmitoyl-D-sphingomyelin is a fatty acid that is derived from sphingomyelin. It has been shown to increase the water permeability of the cell membrane and alter the thermal expansion coefficient, which may be useful in diagnosis of cancer. In addition, N-palmitoyl-D-sphingomyelin has been shown to decrease cell viability and induce apoptosis in HL60 cells through electrochemical impedance spectroscopy (EIS) techniques. The phase transition temperature of N-palmitoyl-D-sphingomyelin has been found to be approximately 28°C. It also forms hydrogen bonds between its own molecules and other molecules due to ester linkages with cholesterol. This may be useful in natural compounds for treating metabolic disorders such as obesity or diabetes.

Purified recombinant PF4V1 protein (His tag)

EMG1 antibody was raised in Rabbit using Human EMG1 as the immunogen