Biochemicals and Reagents

Purified recombinant Plasmodium vivax pLDH protein (His tag)

Rabbit polyclonal HIV1 tat antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6495

Rabbit polyclonal EEA1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CEP55 antibody, catalog no. 70R-2147

Rabbit polyclonal IL13 antibody (biotin)

Please enquire for more information about N-Methyl moxifloxacin hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A5 antibody, catalog no. 70R-7145

AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Peptide H-NDPTQQIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NDPTQQIPK^-OH include the following: Antigen 85B peptidomic analysis allows species-specific mycobacterial identification W Zhang, Q Shu , Z Zhao , J Fan , CJ Lyon, AM Zelazny - Clinical Proteomics, 2018 - Springerhttps://link.springer.com/article/10.1186/s12014-017-9177-6

The LILRB4 antibody is a monoclonal antibody that specifically targets the LILRB4 protein. This protein is known to play a role in immune regulation and has been found to be involved in various diseases, including cancer and autoimmune disorders. The LILRB4 antibody works by neutralizing the activity of the LILRB4 protein, thereby modulating immune responses. This antibody has been extensively studied and shown to have potent inhibitory effects on interferon production and growth factor signaling pathways. It has also been found to bind to cardiac muscle troponin, suggesting its potential use in cardiovascular disease research. The LILRB4 antibody is produced using advanced techniques that ensure high purity and specificity. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. Additionally, this antibody has low cross-reactivity with other proteins, ensuring accurate and reliable results. Furthermore, the LILRB4 antibody has been proven effective in blocking

Substrate peptide for Scr, tyrosine kinase, for use in in vitro assays for Src activity.Src is a member of the Src Family tyrosine Kinases (SFKs), a large cytosolic, non-receptor, kinase family that controls multiple signalling pathways in animal cells. Src is a tyrosine kinase proto-oncogene and elevated levels of Src protein are seen in different tumours including: breast- lung- thyroid- glioblastoma- colorectal- pancreatic- prostate- gastric- biliary tract and skin cancer. Src levels are often associated with tumour progression, metastasis, and a poor clinical outcome and therefore Src has been investigated as a therapeutic target.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

Mouse sequence expressed in sf Insect Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

Purified Avidin protein (Texas Red) from hen egg white

Please enquire for more information about 3-Acenaphthenamine including the price, delivery time and more detailed product information at the technical inquiry form on this page

The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion. In addition to its antiviral properties, the SMAD6 antibody has been shown to have a wide range of applications in life sciences research. It can be used as a tool for studying cellular processes involving serine proteases, such as cell signaling pathways and protein degradation. The antibody can also be utilized in immunohistochemistry and Western blotting techniques to detect and quantify the expression levels of target proteins. Furthermore, the SMAD6 antibody exhibits excellent specificity and sensitivity, making it an ideal choice for various research applications. Its high affinity for its target antigen ensures accurate detection and reliable results. Whether you are investigating interferon signaling or studying the role of

LDLRAD3 antibody was raised in rabbit using the middle region of LDLRAD3 as the immunogen

Peptide H-ELLESYIDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELLESYIDGR^-OH include the following: Development of aptamer-conjugated magnetic graphene/gold nanoparticle hybrid nanocomposites for specific enrichment and rapid analysis of thrombin by MALDI Y Xiong, C Deng , X Zhang - Talanta, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914014004299 Highly sensitive thrombin detection by matrix assisted laser desorption ionization-time of flight mass spectrometry with aptamer functionalized core-shell Fe3O4@ C X Zhang, S Zhu, C Deng , X Zhang - Talanta, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914011009490 Aptamer functionalized and reduced graphene oxide hybridized porous polymers SPE coupled with LC-MS for adsorption and detection of human alpha-thrombin W Zhang, H Hu, G Ruan, Y Huang, F Du - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03776-9 Magnetic materials for the selective analysis of peptide and protein biomarkers S Piovesana , A Laura Capriotti - Current Medicinal Chemistry, 2017 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cmc/2017/00000024/00000005/art00003 Proteolytic signatures define unique thrombin-derived peptides present in human wound fluid in vivo R Saravanan , SS Adav , YK Choong - Scientific reports, 2017 - nature.comhttps://www.nature.com/articles/s41598-017-13197-3 Application of Nanomaterials to Separation of Low-Abundance Proteins N Sun , C Deng , X Shen, N Sun, C Deng - of Nanomaterials in , 2021 - Springerhttps://link.springer.com/chapter/10.1007/978-981-16-5816-7_2 Discovery of screening biomarkers for major depressive disorder in remission by proteomic approach H Choi, S Mun, EJ Joo, KY Lee, HG Kang, J Lee - Diagnostics, 2021 - mdpi.comhttps://www.mdpi.com/2075-4418/11/3/539 Discovery of Screening Biomarkers for Major Depressive Disorder in Remission by Proteomic Approach. Diagnostics 2021, 11, 539 H Choi, S Mun, EJ Joo, KY Lee, HG Kang, J Lee - 2021 - search.proquest.comhttps://search.proquest.com/openview/158ab01962334b2710ea5e983e28ff2c/1?pq-origsite=gscholar&cbl=2032410 Aptamer-functionalized solid phase microextraction-liquid chromatography/tandem mass spectrometry for selective enrichment and determination of thrombin F Du, MN Alam , J Pawliszyn - Analytica chimica acta, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267014010010

Rabbit polyclonal Thioredoxin'antibody (biotin)

Streptophenazine K is a medicinal analog that has been shown to have potent anticancer properties. It acts as a protein kinase inhibitor, preventing the phosphorylation of key proteins involved in cell cycle regulation and apoptosis. This leads to the inhibition of tumor growth and cancer cell proliferation. Streptophenazine K has been found in the urine of Chinese patients with cancer, indicating its potential use as a diagnostic marker for this disease. Studies have shown that Streptophenazine K is effective against a variety of human cancer cell lines, making it a promising candidate for further development as an anticancer therapy. Its ability to selectively target cancer cells while sparing healthy cells makes it an attractive option for cancer treatment.

Mouse monoclonal EPN2 antibody

MEGF11 antibody was raised in rabbit using the middle region of MEGF11 as the immunogen

Rabbit polyclonal GRIN2A antibody (N-terminus)

Peptide H-IVKWDRDM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IVKWDRDM-OH include the following: Use of Anti-(beta2 Microglobulin) mAb to Study Formation of Amyloid Fibrils M Stoppini, V Bellotti, P Mangione - European journal of , 1997 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1997.t01-2-00021.x

Rat monoclonal CD117 antibody

LSD-BSA Conjugated Hapten

Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AMHVAQPAVVLASSR^-OH include the following: Application of nSMOL coupled with LC-MS bioanalysis for monitoring the Fc-fusion biopharmaceuticals Etanercept and Abatacept in human serum N Iwamoto, K Yokoyama, M Takanashi - Pharmacology , 2018 - Wiley Online Libraryhttps://bpspubs.onlinelibrary.wiley.com/doi/abs/10.1002/prp2.422 Expression of recombinant CTLA-4 and PD-L1 proteins fused with thioredoxin, and determination of their ligand-binding activities A Zhansaya, N Malika, D Boris, T Kanat - of Biochemistry & , 2022 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC9455179/

H-NPNLPPETVDSLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NPNLPPETVDSLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NPNLPPETVDSLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NPNLPPETVDSLK-OH at the technical inquiry form on this page

Mouse monoclonal Notch 1 antibody (PE)

Rabbit polyclonal FANCD2 antibody (Ser222)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF228 antibody, catalog no. 70R-8304

18-418 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAA EVKKPAAAAA PGTAEKLSPK AATLAERSAG LAFSLYQAMA KDQAVENILV SPVVVASSLG LVSLGGKATT ASQAKAVLSA EQLRDEEVHA GLGELLRSLS NSTARNVTWK LGSRLYGPSS VSFADDFVRS SKQHYNCEHS KINFRDKRSA LQSINEWAAQ TTDGKLPEVT KDVERTDGAL LVNAMFFKPH WDEKFHHKMV DNRGFMVTRS YTVGVMMMHR TGLYNYYDDE KEKLQIVEMP LAHKLSSLII LMPHHVEPLE RLEKLLTKEQ LKIWMGKMQK KAVAISLPKG VVEVTHDLQK HLAGLGLTEA IDKNKADLSR MSGKKDLYLA SVFHATAFEL DTDGNPFDQD IYGREELRSP KLFYADHPFI FLVRDTQSGS LLFIGRLVRP KGDKMRDEL

Please enquire for more information about Fmoc-N-Lys-(dPEG®12-Biotin)-OH-(Acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Portion of EBV LMP2A

The Human Growth Hormone antibody is a reactive monoclonal antibody that specifically targets and neutralizes the human serum albumin protein. This antibody has been extensively studied in the field of Life Sciences and has shown potential therapeutic applications. It can be used to inhibit the activity of growth hormone or other agonist proteins, making it an important tool for research and development. The Human Growth Hormone antibody is highly specific and binds to a cell antigen with high affinity. Its unique properties make it suitable for various applications, including immunoassays, Western blotting, and immunohistochemistry. Researchers can use this antibody to detect and quantify the presence of growth hormone or related proteins in biological samples. Furthermore, this monoclonal antibody has been found to be effective against autoantibodies that target growth hormone or its receptors. By blocking the interaction between these autoantibodies and their targets, the Human Growth Hormone antibody can potentially alleviate symptoms associated with autoimmune disorders. In addition to its therapeutic potential,

Rabbit polyclonal FAK antibody

Affinity purified Rabbit polyclonal Caspase 6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM54A antibody, catalog no. 70R-3511

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNRG antibody, catalog no. 70R-1507

H-NSIRLSLSQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NSIRLSLSQ-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NSIRLSLSQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NSIRLSLSQ-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of OLFM4 antibody, catalog no. 70R-1580

Sm/RNP Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Sm/RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.