Biochemicals and Reagents

Applications 1-Amino-8-naphthol-4-sulfonic Acid is used in the synthesis of dye compounds.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC4172 antibody, catalog no. 70R-6992

Mouse monoclonal TCP11L2 antibody

ARF3 antibody was raised in Rabbit using Human ARF3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Gtf2b antibody, catalog no. 70R-9577

1-(2-Deoxy-2-fluoro-β-D-arabinofuranosyl)thymine (2’-FANA-T)

Please enquire for more information about CGA Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of Porcn antibody, catalog no. 70R-8827

SCR-1481B1 is an innovative nanocarrier system, which is developed from biomimetic polymers with ligand-targeted capabilities. This system functions by leveraging surface-functionalized nanoparticles to deliver therapeutic agents directly to specific cell types, thereby enhancing efficacy and reducing off-target effects. The intricate design of SCR-1481B1 allows it to bypass common biological barriers and achieve high-efficiency delivery, making it a compelling tool in precision medicine. The applications of SCR-1481B1 are primarily focused in oncology, where its ability to target cancerous tissues and minimize damage to healthy cells is invaluable. Additionally, due to its adaptable framework, it holds potential in treating a broader spectrum of diseases requiring targeted therapy delivery, such as neurodegenerative and cardiovascular conditions. By optimizing pharmacokinetics and biodistribution, SCR-1481B1 represents a significant advancement in the field of drug delivery systems.

Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GPFPIIV-OH include the following: Absolute quantitation of peptides and proteins by coulometric mass spectrometry after derivatization PIJ Fnu , M Tanim-Al Hassan , T Yaroshuk , Y Ai - International Journal of ..., 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380623001446 Identification of antibacterial and immunomodulatory bioactive peptides generated from buffalo (Bubalus bubalis) colostrum whey fermented by Lactobacillus R Kashyap , KS Narayan , S Vij - Journal of Functional Foods, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1756464622002286 Identification and screening of potential bioactive peptides with sleep-enhancing effects in bovine milk casein hydrolysate J Qian, L Zheng, G Su, M Huang , D Luo- Journal of Agricultural ..., 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jafc.1c03937 An anticoagulant peptide from beta-casein: identification, structure and molecular mechanism H Liu, M Tu, S Cheng , H Chen, Z Wang , M Du - Food & function, 2019 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2019/fo/c8fo02235f Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine casein by Lactobacillus casei Shirota R Rojas-Ronquillo , A Cruz-Guerrero - International Dairy ..., 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0958694612001161 Structural determinants of the immunomodulatory properties of the C-terminal region of bovine β-casein F Bonomi, R Brandt, S Favalli, P Ferranti , O Fierro- International dairy ..., 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0958694611001130 Structural determinants of the immunoregulatory activity of milk-derived peptides: the C-terminal sequences of bovine beta-casein S Iametti , A Barbiroli, E Ragg, P Ferranti , O Fierro- 2009 - air.unimi.ithttps://air.unimi.it/handle/2434/67735 Degradation of a bitter peptide derived from casein by lactic acid bacterial peptidase T Shimamura, T Nishimura, A Iwasaki- Food science and ..., 2009 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/fstr/15/2/15_2_191/_article/-char/ja/ Debittering and Hydrolysis of a Tryptic Hydrolysate of β-casein with Purified General and Proline Specific Aminopeptidases from Lactococcus lactis ssp. cremoris PJ Bouchier, G O'cuinn, D Harrington- Journal of food ..., 2001 - Wiley Online Libraryhttps://ift.onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2621.2001.tb15179.x

Peptide H-DSLYLQMNSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSLYLQMNSLR-OH include the following: Simplifying MS-MRD in the Blood of Multiple Myeloma Patients with an Off-the-Shelf Calibrator P Langerhorst, C Wijnands - A new era in M , 2023 - repository.ubn.ru.nlhttps://repository.ubn.ru.nl/bitstream/handle/2066/296434/296434.pdf?sequence=1#page=89 M-protein diagnostics in multiple myeloma patients using ultra-sensitive targeted mass spectrometry and an off-the-shelf calibrator C Wijnands, P Langerhorst , S Noori - Clinical Chemistry and , 2024 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/cclm-2023-0781/html

A synthetic peptide for use as a blocking control in assays to test for specificity of COX10 antibody, catalog no. 70R-6465

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPN11 antibody, catalog no. 70R-9404

APR 246 is a methyltransferase inhibitor that has been shown to be effective against tumor cells. It acts by inhibiting the activity of DNA methyltransferases, which are enzymes that catalyze the transfer of methyl groups to DNA. This inhibition inhibits the process of epigenetic regulation and leads to apoptosis. APR 246 has also been shown to inhibit receptor activity, cell adhesion, and cell proliferation in synergistic cells. The compound is an antagonist for mutant p53 and has been found to induce caspase-independent cell death in cancer cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZMYND19 antibody, catalog no. 70R-8988

Mouse monoclonal MTMR14 antibody

Mouse Monoclonal FSCN1 antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

1-Palmitoyl-2-cis-9,10-methylenehexadecanoyl -sn-glycero-3-phosphoethanolamine is a synthetic lipid with a phospholipid head group that has been used as a research tool to study the activity of ion channels and receptors. The compound is an activator of potassium channels and has been shown to inhibit the action of ligand gated ion channels. It is also an inhibitor of sodium channels. 1PMSGPE has been shown to bind to some peptides, including vasopressin, at high affinity and with high specificity. The following product descriptions are for a hypothetical company called "Nanobio". Rifapentine: Rifapentine is an anti-tuberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis.

Ac-Nle-Pro-Nle-Asp-AMC is a reactive molecule that has been shown to be neuroprotective and to inhibit insulin resistance in mammalian cells. Ac-Nle-Pro-Nle-Asp-AMC is able to stop neuronal death by binding to the proteolytic enzymes, such as ubiquitin ligases, and inhibiting their activity. This drug also inhibits the activity of c2c12 myotubes, which are muscle cells that have been used in research studies. Ac-Nle-Pro-Nle-Asp AMC binds to ubiquitin and prevents it from being degraded by the proteasome system, which is a cellular protein degradation pathway. Ac-Nle-Pro-Nle -Asp AMC also inhibits the release of inflammatory factors from c2c12 myotubes, which may be due to its ability to block ubiquitin ligases.

Please enquire for more information about C.I.Direct green 89 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Benzodiazepines antibody was raised in sheep using benzodiazepine-BSA as the immunogen.

Ald-PEG4-NHS ester

Peptide Cyc-RGGLCYCRGRFCVCVGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Cyc-RGGLCYCRGRFCVCVGR-NH2 include the following: In vitro activity and in vivo animal model efficacy of IB-367 alone and in combination with imipenem and colistin against Gram-negative bacteria O Simonetti, O Cirioni , R Ghiselli, F Orlando , C Silvestri - Peptides, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S019697811400045X In vitro activity of the protegrin IB-367 alone and in combination compared with conventional antifungal agents against dermatophytes O Simonetti, C Silvestri, D Arzeni, O Cirioni - Mycoses, 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/myc.12148 IB-367, a protegrin peptide with in vitro and in vivo activities against the microflora associated with oral mucositis DA Mosca, MA Hurst, W So, BSC Viajar - Antimicrobial agents , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/aac.44.7.1803-1808.2000 Antiendotoxin activity of protegrin analog IB-367 alone or in combination with piperacillin in different animal models of septic shock A Giacometti , O Cirioni , R Ghiselli, F Mocchegiani - Peptides, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978103003498

Rabbit polyclonal NUDT1 antibody

hCG alpha antibody (HRP) was raised in mouse using hCG alpha subunit as the immunogen.

Rofecoxib is a non-steroidal anti-inflammatory drug (NSAID) that belongs to the coxib class of drugs. It is used for the relief of pain, inflammation, and stiffness associated with osteoarthritis and rheumatoid arthritis. Rofecoxib inhibits cyclooxygenase-2 (COX-2), which is responsible for making prostaglandins. COX-2 inhibitors are also used as an analgesic in cancer patients and those with chronic inflammatory diseases. Celecoxib is another NSAID that belongs to the coxib class of drugs. It has been shown to be effective in treating pain and inflammation in osteoarthritis and rheumatoid arthritis patients. These drugs may have long-term toxicity effects, such as increased risk of cancer or other diseases, but more research needs to be done before these conclusions can be made.

Purified Polyclonal GTF2E2 antibody

TRAFD1 antibody was raised in rabbit using the C terminal of TRAFD1 as the immunogen

Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.

Please enquire for more information about BCAT, Benzotriazole-1-carboxamidinium tosylate including the price, delivery time and more detailed product information at the technical inquiry form on this page

RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV

Rabbit Polyclonal HER2 antibody (Tyr877)

Mouse monoclonal SERPINB4 antibody

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Recombinant Human CD4 protein (His tag)

Purified recombinant IL8 protein (His tag)

Purified recombinant Dengue NS1 protein (N-terminal) (GST tag)

Peptide H-GYIGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GYIGSR-OH include the following: of central nervous system neurons with poly (tetrafluoroethylene-co-hexafluoropropylene) via a novel surface amine-functionalization reaction followed by peptide YW Tong , MS Shoichet - Journal of Biomaterials Science, Polymer , 1998 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1163/156856298X00109 Enhancing the neuronal interaction on fluoropolymer surfaces with mixed peptides or spacer group linkers YW Tong , MS Shoichet - Biomaterials, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961200003380 Peptide surface modification of poly(tetrafluoroethylene-co-hexafluoropropylene) enhances its interaction with central nervous system neurons YW Tong , MS Shoichet - Research: An Official Journal of The , 1998 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-4636(199810)42:1%3C85::AID-JBM11%3E3.0.CO;2-N Covalent bonding of GYIGSR to EVAL membrane surface to improve migration and adhesion of cultured neural stem/precursor cells YC Li , YT Liao, HH Chang, TH Young - Colloids and Surfaces B , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0927776512005024 Fabrication of intracranial vascular nitinol alloy stents with improved mechanical property and endothelialization function Y Yan, N Li, F Guo, A Wu, W Jin, R Yang, Y Bai - Acta Metallurgica Sinica , 2022 - Springerhttps://link.springer.com/article/10.1007/s40195-022-01435-1 Polymers for Tissue Engineering, pp. 127-143 Molly S. Shoichet and Jeffrey A. Hubbell (Eds) VSP 1998. Y TONG¹ - Polymers for Tissue Engineering, 1998 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=4aDdoLuKS3oC&oi=fnd&pg=PA127&dq=(%22GYIGSR%22+OR+%22NH2-Gly-Tyr-Ile-Gly-Ser-Arg-OH%22+OR+%22H-GYIGSR-OH%22)+AND+peptide&ots=a-uJ1uIx6R&sig=IYuLalMMAN-eHxn9hu33-GRgNfY Polymers for Tissue Engineering, pp. 127-143 Molly S. Shoichet and Jeffrey A. Hubbell (Eds) VSP 1998. Y TONG¹ - Polymers for Tissue Engineering, 1998 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=4aDdoLuKS3oC&oi=fnd&pg=PA127&dq=(%22GYIGSR%22+OR+%22NH2-Gly-Tyr-Ile-Gly-Ser-Arg-OH%22+OR+%22H-GYIGSR-OH%22)+AND+peptide&ots=a-uJ1uIx9Q&sig=jIGsPojt7CpYxS-p4i210jAnCd4 Neuron-ligand pathfinding on surfaces modified by laminin and laminin-derived peptides Y Leng - 2006 - search.proquest.comhttps://search.proquest.com/openview/6076a10c3d7bd7fb1e4cb074683256f9/1?pq-origsite=gscholar&cbl=18750&diss=y Peptide immobilization on polyethylene terephthalate surfaces to study specific endothelial cell adhesion, spreading and migration Y Lei, M Remy, C Labrugacašre, MC Durrieu - Journal of Materials Science , 2012 - Springerhttps://link.springer.com/article/10.1007/s10856-012-4736-x Synthetic pentapeptide from the B1 chain of laminin promotes B16F10 melanoma cell migration Y Iwamoto, J Graf, M Sasaki - Journal of cellular , 1988 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jcp.1041340216 Cell-binding peptides conjugated to poly (ethylene glycol) promote neural cell aggregation W Dai, J Belt, WM Saltzman - Bio/Technology, 1994 - nature.comhttps://www.nature.com/articles/nbt0894-797 Peptide Surface Modification of P(HEMA-co-MMA)-b-PIB-b-P(HEMA-co-MMA) Block Copolymers U Ojha , D Feng, A Chandekar , JE Whitten , R Faust - Langmuir, 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/la9000768 Covalently immobilized laminin peptide Tyr-Ile-Gly-Ser-Arg (YIGSR) supports cell spreading and co-localization of the 67-kilodalton laminin receptor with SP Massia, SS Rao, JA Hubbell - Journal of Biological Chemistry, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818530623 Synthesis of cell-adhesive dextran hydrogels and macroporous scaffolds SG Levesque, MS Shoichet - Biomaterials, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S014296120600531X Laminin surface binding sites and metastatic potential of 3LL tumor cells, increased by indomethacin SF Ali , FJ Unda , G Perez-Yarza - Biochemical and biophysical research , 1990 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006291X9092086F Surface-functionalized silk fibroin films as a platform to guide neuron-like differentiation of human mesenchymal stem cells S Manchineella , G Thrivikraman , B Basu - applied materials & , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsami.6b06403 Peptide modification of polysaccharide scaffolds for targeted cell signaling S Levesque, R Wylie , Y Aizawa, M Shoichet - Natural-based Polymers for , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9781845692643500093 Laminin oligopeptide derivatized agarose gels allow three-dimensional neurite extension in vitro R Bellamkonda , JP Ranieri - Journal of neuroscience , 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jnr.490410409 Covalent bonding of YIGSR and RGD to PEDOT/PSS/MWCNT-COOH composite material to improve the neural interface K Wang, RY Tang, XB Zhao, JJ Li , YR Lang, XX Jiang - Nanoscale, 2015 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2015/nr/c5nr05784a Accelerated neural differentiation of mouse embryonic stem cells on aligned GYIGSR-functionalized nanofibers EA Silantyeva , W Nasir, J Carpenter, O Manahan - Acta biomaterialia, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1742706118303313

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR3B antibody, catalog no. 70R-3557

IL18 antibody was raised in rabbit using the C terminal of IL18 as the immunogen

Pyr-Val-OH is a molecule that is catalysed by the enzyme histone deacetylase. Pyr-Val-OH has been shown to inhibit cancer cell proliferation and growth. Pyr-Val-OH also has been shown to reduce bacterial vaginosis in mice with bacterial vaginosis, as well as nephrology dialysis patients. Pyr-Val-OH is a diagnostic marker for cancer, bacterial vaginosis and nephrology dialysis patients. It can be used to diagnose these conditions by profiling specific metabolic profiles. This molecule may also be used in the diagnosis of bladder cancer, as it reacts with amp-activated protein, which is elevated in bladder cancer patients.

Please enquire for more information about H-Hyp-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

1-558 amino acids: MGSSHHHHHH SSGLVPRGSH MAALTRDPQF QKLQQWYREH RSELNLRRLF DANKDRFNHF SLTLNTNHGH ILVDYSKNLV TEDVMRMLVD LAKSRGVEAA RERMFNGEKI NYTEGRAVLH VALRNRSNTP ILVDGKDVMP EVNKVLDKMK SFCQRVRSGD WKGYTGKTIT DVINIGIGGS DLGPLMVTEA LKPYSSGGPR VWYVSNIDGT HIAKTLAQLN PESSLFIIAS KTFTTQETIT NAETAKEWFL QAAKDPSAVA KHFVALSTNT TKVKEFGIDP QNMFEFWDWV GGRYSLWSAI GLSIALHVGF DNFEQLLSGA HWMDQHFRTT PLEKNAPVLL ALLGIWYINC FGCETHAMLP YDQYLHRFAA YFQQGDMESN GKYITKSGTR VDHQTGPIVW GEPGTNGQHA FYQLIHQGTK MIPCDFLIPV QTQHPIRKGL HHKILLANFL AQTEALMRGK STEEARKELQ AAGKSPEDLE RLLPHKVFEG NRPTNSIVFT KLTPFMLGAL VAMYEHKIFV QGIIWDINSF DQWGVELGKQ LAKKIEPELD GSAQVTSHDA STNGLINFIK QQREARVQ

Rabbit polyclonal HIV-2 antibody (biotin)

Mouse sequence expressed in E. coli Cells; purity >95% by SDS-PAGE and analyzed by silver stain.