Biochemicals and Reagents

Peptide H-EGYLQIGANTQAAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EGYLQIGANTQAAQK-OH include the following: Enhanced peptide quantification using spectral count clustering and cluster abundance S Lee, MS Kwon , HJ Lee , YK Paik, H Tang , JK Lee- BMC ..., 2011 - Springerhttps://link.springer.com/article/10.1186/1471-2105-12-423

D4S234E antibody was raised in rabbit using the N terminal of D4S234E as the immunogen

PDGF BB antibody was raised in rabbit using highly pure recombinant human PDGF-BB as the immunogen.

Venturicidin A

Fluorescent probe

Please enquire for more information about anti-Plasmodium falciparum HRP II Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Recombinant Hepatitis C Virus NS3 Genotype-3 (1356-1459)

Ramoplanin A2 is a new microbicide that has been shown to have antimicrobial activity against human pathogens. Ramoplanin A2 is a novel synthetic compound with a broad spectrum of activity against Gram-positive and Gram-negative bacteria. The molecule was designed by using chemical methods to attach two fatty acids, myristic acid and lauric acid, to the antibiotic ramoplanin, a natural product. Ramoplanin A2 has been shown to be effective against drug-resistant bacteria, such as methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant enterococci (VRE). The molecule is biocompatible and can be synthesized in an asymmetric fashion using a simple chemical reaction.

Rabbit polyclonal PBOV1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Lyrm4 antibody, catalog no. 70R-9499

The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (321-335) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

A synthetic peptide for use as a blocking control in assays to test for specificity of WDSUB1 antibody, catalog no. 70R-2815

HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG

BSA conjugated Nitrofurantoin Hapten

1-((1H-Indazol-5-yl)sulfonyl)-N-ethyl-N-(2-(trifluoromethyl)benzyl)piperidine-4-carboxamide is a known ligand for the ion channel TRPV1. It is a potent activator of this channel, and can be used as a research tool for studying the function of this channel. 1-(1H-indazol-5-ylsulfonyl)-N,N'-diethylpiperidine 4-[(2-(trifluoromethyl)benzoyl)]carboxamide (IUPAC name: N-[(5H)-indazol-5-ylsulfonyl]ethyl}benzenebutanoic acid N,N'-diethyl ester) was synthesized by reacting 5H indazole with ethylene diamine in the presence of triethy

γ-Cyclodextrin

Mouse monoclonal Cytokeratin 19 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SOCS7 antibody, catalog no. 70R-5835

H-YARKRSAHTNDVKQL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YARKRSAHTNDVKQL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YARKRSAHTNDVKQL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YARKRSAHTNDVKQL-OH at the technical inquiry form on this page

Purified Polyclonal XRCC3 antibody

TentaGel; is a gelatinous resin, an important support for solid phase synthesis. TentaGel; resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. particle size: 200 - 250 µmcapacity: 0.2 - 0.3 mmol/g1.5 nmol/bead; 160 000 beads/g. These resins are designed for single bead synthesis and single bead analysis (mean particle size 200-250 µm: capacity 02-03 meq/g).

Goat anti-chicken IgG (H+L) (FITC) was raised in goat using chicken IgG whole molecule as the immunogen.

NOX2 Monoclonal Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN1 antibody, catalog no. 70R-7393

MeOSuc-Ala-Ala-Pro-Met-AMC is a substrate for the aminopeptidase. It has been shown to have minimal effects on intestinal cells and analyzed peptidases, proteolytic peptidases, and aminopeptidases. This compound is not pathogenic and can be used as a modulator of oncospheres and parasites.

anti-Horse Hemoglobin Antibody

PARK7 antibody was raised in rabbit using residues 167-189 (AIVEALNGKEVAAQVKAPLVLKD) of human PARK7 (DJ-1) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC70863 antibody, catalog no. 70R-4813

Endothelin receptor antagonist; vasodilator

A synthetic peptide for use as a blocking control in assays to test for specificity of GLMN antibody, catalog no. 70R-5817

Rabbit polyclonal MEK2 antibody

Conglobatin

Purified Polyclonal PIGW antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TNRC6B antibody, catalog no. 70R-4949

CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6748

Mouse monoclonal NMT2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF38A antibody, catalog no. 70R-10153

Mouse monoclonal Paxillin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIPL antibody, catalog no. 70R-9911

Mycophenolic acid-O-β-D-glucuronide

2,3,4,6-Tetra-O-benzyl-D-mannopyranose

A synthetic peptide for use as a blocking control in assays to test for specificity of SENP3 antibody, catalog no. 70R-3545

Rabbit polyclonal MMP3 antibody

Rabbit polyclonal RAD51 antibody (Thr309)

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.