Biochemicals and Reagents

Rabbit polyclonal PITPNM1 antibody (HRP)

Purified Mouse IgG (Fab'2)

TRANSCRIPTME RNA Kit - cDNA synthesis kit

6-Maleimidohexanoic acid is used as a probe for introducing maleimides groups into biomolecules and active pharmaceutical ingredients. Further, it is used with N-hydroxysuccinimide ester as a bifunctional cross-linking reagent. In addition to this, it acts as a probe for thiol groups in membrane proteins. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Recombinant Gpt protein (His tagged)

Potassium-competitive acid blocker; inhibitor of gastric H+/K+ -ATPase

Antagonist of proto-oncogene MDM2 and its interaction with p53

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Please enquire for more information about Pd-173074-d9 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Zinviroxime including the price, delivery time and more detailed product information at the technical inquiry form on this page

DHX29 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 29 (Dhx29)

Influenza B antibody was raised in mouse using Influenza B as the immunogen.

OTUB2 antibody was raised in rabbit using the N terminal of OTUB2 as the immunogen

Purified recombinant ATP5F1 protein (His tag)

Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)

CD69 antibody was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

Recombinant Hepatitis C Virus NS3 Genotype-4 (1356-1459)

Recombinant Hepatitis B Surface Antigen adr subtype, Saccharomyces

HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.

1-323 amino acids: MGSSHHHHHH SSGLVPRGSH MYHNSSQKRH WTFSSEEQLA RLRADANRKF RCKAVANGKV LPNDPVFLEP HEEMTLCKYY EKRLLEFCSV FKPAMPRSVV GTACMYFKRF YLNNSVMEYH PRIIMLTCAF LACKVDEFNV SSPQFVGNLR ESPLGQEKAL EQILEYELLL IQQLNFHLIV HNPYRPFEGF LIDLKTRYPI LENPEILRKT ADDFLNRIAL TDAYLLYTPS QIALTAILSS ASRAGITMES YLSESLMLKE NRTCLSQLLD IMKSMRNLVK KYEPPRSEEV AVLKQKLERC HSAELALNVI TKKRKGYEDD DYVSKKSKHE EEEWTDDDLV ESL

Rabbit polyclonal SRY antibody

H-IQESSPAILINTK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IQESSPAILINTK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IQESSPAILINTK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IQESSPAILINTK-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A4 antibody, catalog no. 70R-6547

Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.

Rabbit polyclonal TMOD1 antibody

Mouse monoclonal LPL antibody

Armenian Hamster monoclonal TCR beta antibody (FITC)

Purified recombinant Human ECH1 protein

Mouse monoclonal Thyroxine antibody

Fbxw7/Cdc4 Monoclonal Antibody (HRP)

Peptide H-KSVTREDTGTYTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KSVTREDTGTYTC-OH include the following: Expression of a recombinant protein of the platelet F11 receptor (F11R)(JAM-1/JAM-A) in insect cells: F11R is naturally phosphorylated in the extracellular domain MH Kedees, A Babinska, M Mahmood Hussain - Platelets, 2005 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/09537100400010329 Development of new antiatherosclerotic and antithrombotic drugs utilizing F11 receptor (F11R/JAM-A) peptides A Babinska, CC Clement , M Swiatkowska - Peptide , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.22503 The F11 receptor (F11R/JAM-A) in atherothrombosis: overexpression of F11R in atherosclerotic plaques A Babinska, BM Azari, MO Salifu, R Liu - Thrombosis and , 2007 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/abstract/10.1160/TH06-08-0454

BTN3A3 antibody was raised in Rabbit using Human BTN3A3 as the immunogen

Rabbit polyclonal Chk1 antibody

Please enquire for more information about Thyroxine-13C6 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Region of MIA protein corresponding to amino acids MGPMPKLADR KLCADQECSH PISMAVALQD YMAPDCRFLT IHRGQVVYVF SKLKGRGRLF WGGSVQGDYY GDLAARLGYF PSSIVREDQT LKPGKVDVKT DKWDFYCQ.

ELISA kit for detection of PECAM1 in the research laboratory

Rabbit polyclonal PNMA1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A22 antibody, catalog no. 70R-6511

Human BRCA2 is a key contributor to DNA damage repair and thus genomic integrity. Along with RAD51, BRCA2 ensures accurate and timely progression of homologous recombination (HR) at sites of double strand breaks to facilitate repair. BRCA2 also has an important additional function at the replication fork. BRCA2 therefore has anti-tumour properties and mutations in human BRCA2 protein cause a predisposition to breast and ovarian cancers and increase susceptibility to other tumorigenic conditions.BRCA2 interacts with RAD51 through a series of eight motifs called BRC repeats and a separate binding site located in the C-terminal region. Among eight BRC repeats involved in RAD51 binding, BRC4 displays the highest affinity for RAD51. The BRC4-RAD51 interaction may inhibit RAD51 oligomerization. Low concentrations of BRC4 enhance RAD51 binding to single stranded DNA and stimulate RAD51-mediated strand exchange, high concentrations of BRC4 disrupt RAD51 filament formation. Contains an N-terminal biotin tag for easy detection and purification.

Peptide H-EGSFQPSQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EGSFQPSQE-OH include the following: Biased T cell receptor usage directed against human leukocyte antigen DQ8-restricted gliadin peptides is associated with celiac disease SE Broughton , J Petersen , A Theodossis, SW Scally - Immunity, 2012 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(12)00419-0.pdf Can dietary fibre help provide safer food products for sufferers of gluten intolerance? A well-established biophysical probe may help towards providing an answer MS Kök, R Gillis , S Ang, D Lafond, AS Tatham - Bmc Biophysics, 2012 - Springerhttps://link.springer.com/article/10.1186/2046-1682-5-10 Computational Alanine Scanning Reveals Common Features of TCR/pMHC Recognition in HLA-DQ8-Associated Celiac Disease L Qiu, J Song, JZH Zhang - Methods for Estimating the Kinetic Parameters , 2022 - Springerhttps://link.springer.com/protocol/10.1007/978-1-0716-1767-0_13 Structural bases of T cell antigen receptor recognition in celiac disease L Ciacchi, HH Reid , J Rossjohn - Current Opinion in Structural Biology, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0959440X22000288 Celiac disease and immunogenic wheat gluten peptides and the association of gliadin peptides with HLA DQ2 and HLA DQ8 KY Woldemariam , J Yuan, Z Wan, Q Yu - Food Reviews , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/87559129.2021.1907755 A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease KN Henderson, JA Tye-Din, HH Reid , Z Chen, NA Borg - Immunity, 2007 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(07)00327-5.pdf and crystallization of the human leukocyte antigen class II molecules HLA-DQ2 and HLA-DQ8 complexed with deamidated gliadin peptides implicated in coeliac KN Henderson, HH Reid , NA Borg - Section F: Structural , 2007 - scripts.iucr.orghttps://scripts.iucr.org/cgi-bin/paper?en5259 Celiac disease: quantity matters F Koning - Seminars in immunopathology, 2012 - Springerhttps://link.springer.com/article/10.1007/s00281-012-0321-0

Factor XIII antibody was raised in sheep using human Factor XIII purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal SAFB1 antibody

Purified Mouse IgG (Fc) FITC conjugate

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIT1 antibody, catalog no. 70R-8332

Affinity purified Rabbit polyclonal Caspase 1 antibody