Biochemicals and Reagents

Applications 1,1'-(1,5-Pentanediyl)bis[1-butylpyrrolidinium] Difluoride is the ionic form of 1,1'-(1,5-Pentanediyl)bis[1-butylpyrrolidinium] [CAS#: 805990-74-3 ] which is used for anion detection by electrospray ionization mass spectrometry with dicationic liquids salts. References Armstrong, Daniel W., et al.: PCT Int. Appl., (2009);

Mouse monoclonal PACSIN3 antibody

Ac-NKPKRSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-NKPKRSFFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-NKPKRSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-NKPKRSFFALRDQI-OH at the technical inquiry form on this page

Peptide H-RMINASVWMPPME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RMINASVWMPPME-OH include the following: Crystal structure of the nuclear effector of Notch signaling, CSL, bound to DNA RA Kovall , WA Hendrickson - The EMBO journal, 2004 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/sj.emboj.7600349

Please enquire for more information about BRD7-IN-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-SAPDTRPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SAPDTRPL-OH include the following: Immunotherapy with glycosylated and anchor-modified MUC1 peptides breaks tolerance in MUC1 transgenic mice V Lakshminarayanan, J Bradley, T Tinder, L Pathangey - Cancer Research, 2008 - AACRhttps://aacrjournals.org/cancerres/article-abstract/68/9_Supplement/2860/548576

Peptide H-YYTSNPTTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YYTSNPTTF-OH include the following: Identification of Novel Candidate CD8+ T Cell Epitopes of the SARS-CoV2 with Homology to Other Seasonal Coronaviruses PD Pushpakumara , D Madhusanka , S Dhanasekara - Viruses, 2021 - mdpi.comhttps://www.mdpi.com/1999-4915/13/6/972 Identification of presented SARS-CoV-2 HLA class I and HLA class II peptides using HLA peptidomics A Nagler, S Kalaora , C Barbolin, A Gangaev - Cell Reports, 2021 - cell.comhttps://www.cell.com/cell-reports/pdf/S2211-1247(21)00681-1.pdf

Rabbit polyclonal GPR123 antibody

Inhibitor of COX-1 and COX-2 cyclooxygenases

Purified Polyclonal PAX8 antibody

2-(Dihydrogen phosphate) D-glucose

Boc-1-amino-4,9-dioxa-12-dodecanamine

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM47 antibody, catalog no. 70R-4958

Rabbit anti-cat IgG (H+L) was raised in rabbit using feline IgG whole molecule as the immunogen.

Peptide H-FRDYVDRFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FRDYVDRFYK-OH include the following: Cytotoxic T cell responses to multiple conserved HIV epitopes in HIV-resistant prostitutes in Nairobi. SL Rowland-Jones , T Dong , KR Fowke - The Journal of , 1998 - Am Soc Clin Investighttps://www.jci.org/articles/view/4314 Associations of the human leukocyte antigen class I genes with vertical HIV-1 transmission and HIV-1 specific CTL responses RD Mackelprang - 2010 - search.proquest.comhttps://search.proquest.com/openview/18626bb9475afe4f1597506d50d6493a/1?pq-origsite=gscholar&cbl=18750 Epitope mapping of the HIV-1 gag region with monoclonal antibodies J Hinkula , J Rosen, T Stigbrand, B Wahren - Molecular immunology, 1990 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016158909090163T Monoclonal Antibodies to Conserved Regions of the Major Core Protein (gag24) of HIV-1 and HIV-2 E CARPIO , C DUARTE, J HINKULA - AIDS research and , 1991 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.1991.7.97 Differences in antigenic profile between natural and recombinant HIV-1 p24 identified with monoclonal and polyclonal antibodies CA Duarte, AE Lopez, J Benaca­tez - Serodiagnosis and immunotherapy in , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0888078696800023

rFGF-9

Rabbit polyclonal IKB alpha antibody

Mouse monoclonal ERK3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of COQ2 antibody, catalog no. 70R-6520

CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME

S-acetyl-PEG3-acid

a-Gliadin (229-246) is derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th1-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.

A synthetic peptide for use as a blocking control in assays to test for specificity of IRAK2 antibody, catalog no. 70R-10272

Recombinant Human Serum Albumin, Plant

Digoxin antibody was raised in mouse using digoxin-BSA as the immunogen.

Rabbit polyclonal PPME1 antibody

Mouse monoclonal C20orf3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBA4A antibody, catalog no. 70R-2911

A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALNT2 antibody, catalog no. 70R-5327

A synthetic peptide for use as a blocking control in assays to test for specificity of KLK13 antibody, catalog no. 70R-3265

CD22 antibody (Allophycocyanin) was raised in rat using CD22 as the immunogen.

Mouse monoclonal MAPRE2 antibody

Malathion β-monoacid is a potent inhibitor of kinases, which play a crucial role in the regulation of cell cycle and apoptosis. It has been shown to induce apoptosis in leukemia and cancer cells by inhibiting protein kinase activity. Malathion β-monoacid has also been found to have medicinal properties as an anticancer agent. Studies have demonstrated its ability to inhibit tumor growth in Chinese hamster ovary cells and human bladder cancer cells. Additionally, it has been observed that this compound can be detected in urine after exposure to malathion, indicating its potential use as a biomarker for malathion exposure. Overall, Malathion β-monoacid is a promising candidate for further investigation as an anticancer drug.

Peptide H-NIQGITKPAIRRLARRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NIQGITKPAIRRLARRG-OH include the following: Mis16 independently recognizes histone H4 and the CENP-ACnp1-specific chaperone Scm3sp S An , H Kim , US Cho - Journal of molecular biology, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283615004878

Purified native Toxoplasma gondii protein (Level 2)

Peptide H-RNGCIVDPRCPYQQCRRPLYCRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RNGCIVDPRCPYQQCRRPLYCRRR-OH include the following: Crop Physiology and Biotechnology SC Bhatla, MA Lal - Plant Physiology, Development and Metabolism, 2023 - Springerhttps://link.springer.com/chapter/10.1007/978-981-99-5736-1_34 A haem-sequestering plant peptide promotes iron uptake in symbiotic bacteria S Sankari , VMP Babu , K Bian , A Alhhazmi - Nature , 2022 - nature.comhttps://www.nature.com/articles/s41564-022-01192-y Important late-stage symbiotic role of the Sinorhizobium meliloti exopolysaccharide succinoglycan MFF Arnold , J Penterman, M Shabab - Journal of , 2018 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jb.00665-17

A synthetic peptide for use as a blocking control in assays to test for specificity of PI16 antibody, catalog no. 70R-6245

Biotin antibody was raised in goat using biotin conjugated to KLH as the immunogen.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

CD25 antibody (FITC) was raised in rat using alpha chain IL-2 receptor as the immunogen.

H-SPGAGSLGSPASQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SPGAGSLGSPASQR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SPGAGSLGSPASQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SPGAGSLGSPASQR-OH at the technical inquiry form on this page

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of IFT88 antibody, catalog no. 70R-9240

Purified recombinant Treponema pallidum TmpA protein

Normal Chicken Serum is a versatile biospecimen that can be used in various life science and veterinary applications. It contains a rich mixture of proteins, growth factors, and antibodies that are naturally present in chicken blood. This serum is commonly used as a control or reference sample in experiments involving liver microsomes, dopamine, TGF-beta, interleukin-6, teriparatide, epidermal growth factor, and other biomolecules. One of the key advantages of Normal Chicken Serum is its neutralizing properties. It contains a wide range of monoclonal antibodies that can effectively neutralize reactive substances and prevent unwanted interactions in assays or cell cultures. This makes it an ideal choice for researchers who need reliable and consistent results. Additionally, Normal Chicken Serum is polymorphic, meaning it exhibits genetic variation among different individuals. This feature allows researchers to study the effects of genetic diversity on various biological processes or diseases. Whether you are conducting basic research or developing new veterinary therapies, Normal Chicken Serum can be a