Peptides

Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GFEPTLEALFGK^-OH include the following: Validation of human ApoB and ApoAI immunoturbidity assays for non-human primate dyslipidemia and atherosclerosis research Z Chen, AM Strack, AC Stefanni, Y Chen, W Wu - Journal of , 2011 - Springerhttps://link.springer.com/article/10.1007/s12265-011-9264-4 Effect of error propagation in stable isotope tracer studies: an approach for estimating impact on apparent biochemical flux SF Previs , K Herath, J Castro-Perez, A Mahsut - Methods in , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687915003687 An iTRAQ approach to quantitative proteome analysis of cerebrospinal fluid from patients with tuberculous meningitis Q Ou, X Liu, X Cheng - Bioscience trends, 2013 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/bst/7/4/7_2013.v7.4.186/_article/-char/ja/ A rapid method for cross-species quantitation of apolipoproteins A1, B48 and B100 in plasma by ultra-performance liquid chromatography/tandem mass spectrometry ME Lassman, TM McLaughlin - Rapid , 2012 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.5296 Impact of serum and plasma matrices on the titration of human inflammatory biomarkers using analytically validated SRM assays M Dupin, T Fortin, A Larue-Triolet, I Surault - Journal of Proteome , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.5b00803 Rapid development of atherosclerosis in the world's smallest microminipig fed a high-fat/high-cholesterol diet a useful animal model due to its size and similarity to H Kawaguchi, T Yamada, N Miura , M Ayaori - of Atherosclerosis and , 2014 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/jat/21/3/21_21246/_article/-char/ja/

Cyclo(L-Pro-L-Pro) is a cyclic peptide that was first synthesized in 1968 by the chemists, K. Brown and H. M. Schuster. Cyclo(L-Pro-L-Pro) has been shown to produce p-hydroxybenzoic acid, an intermediate in the metabolism of dopamine, when incubated with human serum or human erythrocytes. In addition, it has been shown to increase locomotor activity and enzyme activities in rats, as well as cytosolic calcium levels in cells. This compound may be a useful experimental model for studying Parkinson's disease because of its ability to inhibit dopamine uptake and increase the production of dopamine from its precursor L-DOPA. It also binds to neurokinin 1 receptor (NK1R), which is involved in inflammatory responses and pain sensation.

Peptide H-DTL^MISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DTL^MISR^-OH include the following: Identification and quantification of immunoglobulin G (G1, G2, G3 and G4) in human blood plasma by high-resolution quadrupole-Orbitrap mass spectrometry Z Huang, XD Pan - RSC advances, 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/ra/c7ra02623d Automated mass spectrometry multi-attribute method analyses for process development and characterization of mAbs YE Song , H Dubois, M Hoffmann , S D́Eri - of Chromatography B, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023221000192 Improvements on sample preparation and peptide separation for reduced peptide mapping based multi-attribute method analysis of therapeutic monoclonal X Li , B Rawal , S Rivera, S Letarte - of Chromatography A, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967322003545 Post-translational Modification Analysis with PEAKS Studio W Zhang, W Sun - bioinfor.comhttps://www.bioinfor.com/wp-content/uploads/2018/11/Application-Note_PTM_v1_1024.pdf Assessing Oxidation in IgG1 Monoclonal Antibodies and Correlating at both Intact Protein and Peptide Levels T Buchanan , S Carillo, K Srzentic , K Scheffler - lcms.labrulez.comhttps://lcms.labrulez.com/labrulez-bucket-strapi-h3hsga3/po_65745_oxidation_igg1_monoclonal_antibodies_asms2020_po65745_en_12891e99e1/po-65745-oxidation-igg1-monoclonal-antibodies-asms2020-po65745-en.pdf Development and validation of an LC-MS/MS method for simultaneous quantification of co-administered trastuzumab and pertuzumab S Schokker , F Fusetti, F Bonardi, RJ Molenaar - MAbs, 2020 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2020.1795492 mD-UPLC-MS/MS: Next generation of mAb characterization by multidimensional ultraperformance liquid chromatography-mass spectrometry and parallel on-column S Oezipek, S Hoelterhoff, S Breuer, C Bell - Analytical , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.1c04450 Inter-laboratory study of an optimised peptide mapping workflow using automated trypsin digestion for monitoring monoclonal antibody product quality attributes S Millan-Martaca­n, C Jakes , S Carillo, T Buchanan - Analytical and , 2020 - Springerhttps://link.springer.com/article/10.1007/s00216-020-02809-z A novel filter-assisted protein precipitation (FAPP) based sample pre-treatment method for LC-MS peptide mapping for biosimilar characterization S Bhattacharya , AS Rathore - Journal of Pharmaceutical and Biomedical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708523002960 Absolute quantitation of immunoglobulin G and its glycoforms using multiple reaction monitoring Q Hong , CB Lebrilla , S Miyamoto - Analytical chemistry, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4009995 A Streamlined Compliant Ready Workflow for Peptide-Based Multi-Attribute Method (MAM) N Ranbaduge, YQ Yu - Waters Application Note, 2020 - waters.comhttps://www.waters.com/content/dam/waters/en/app-notes/2020/720007094/720007094-zh_tw.pdf Surface Plasmon Resonance and Liquid Chromatography-Mass Spectrometry Techniques for Antibody Bioanalysis M Shen - 2018 - digitalcommons.lib.uconn.eduhttps://digitalcommons.lib.uconn.edu/cgi/viewcontent.cgi?article=7995&context=dissertations Antibody Drug Conjugate Bioanalysis using the BioBA Solution M Deng, I Moore - sciex.jphttps://sciex.jp/content/dam/SCIEX/pdf/tech-notes/all/ADC-Bioanalysis-BioBA-solution.pdf Development of an analytical method to assess the occupational health risk of therapeutic monoclonal antibodies using LC-HRMS LMH Reinders, MD Klassen, M Jaeger - Analytical and , 2018 - Springerhttps://link.springer.com/article/10.1007/s00216-018-0966-1 Detection and Measurement of Methionine Oxidation in Proteins KI Sen , R Hepler, H Nanda - Current Protocols in Protein , 2017 - Wiley Online Libraryhttps://currentprotocols.onlinelibrary.wiley.com/doi/abs/10.1002/cpps.25 Novel Multidimensional Liquid Chromatography Workflow with In-Loop Enzymatic Digests of Multiple Heart-Cuts for Fast and Flexible Characterization of K Mayr, T Weindl, A Gaertner, J Camperi - Analytical , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.2c04467 What sample preparation should be chosen for targeted MS monoclonal antibody quantification in human serum? J Vialaret , S Broutin, C Pugnier, S Santele, A Jaffuel - Bioanalysis, 2018 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2018-0027 Peptide-directed photo-cross-linking for site-specific conjugation of IgG J Park, Y Lee, BJ Ko , TH Yoo - Bioconjugate chemistry, 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.bioconjchem.8b00515 "œLab of the Future"â”€ Today: fully automated system for high-throughput Mass spectrometry analysis of biotherapeutics HE Waldenmaier, E Gorre, ML Poltash - Journal of the , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.3c00036 Differentiation of leucine and isoleucine for enhanced sequence variant analysis using electron activated dissociation H Liu, Z Zhang - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/MKT-30799-A_Leu_Ile_isomers_ZenoTOF7600_Final.pdf General LC-MS/MS method approach to quantify therapeutic monoclonal antibodies using a common whole antibody internal standard with application to preclinical H Li, R Ortiz, L Tran, M Hall , C Spahr, K Walker - Analytical , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac202792n Interlaboratory evaluation of a user-friendly benchtop mass spectrometer for multiple-attribute monitoring studies of a monoclonal antibody CI Butre, V D'atri , H Diemer, O Colas, E Wagner - Molecules, 2023 - mdpi.comhttps://www.mdpi.com/1420-3049/28/6/2855 Lc-Ms/Ms Method for Quantifying the Hiv-1 Broadly Neutralizing Antibody Pgt 121.414. Ls in Human Serum CE Gould, Q Ma , R Cha, KJ Zemaitis , R DiFrancesco - Ls in Human - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=4811619 A Robust and Generic Method for Quantification of Monoclonal Antibody Therapeutics in Biological Matrices C Liu , I Moore, W Woroniecki, L Xiong, HF Liu, G Impey - sciex.comhttps://www.sciex.com/content/dam/SCIEX/pdf/tech-notes/all/BioBA-Robust_Method_Quant_mAb_Therapeutics.pdf Monitoring of On-column Methionine Oxidation as Part of a System Suitability Test During UHPLC-MS/MS Peptide Mapping B Mautz, M König, V Larraillet - LCGC , 2019 - chromatographyonline.comhttps://www.chromatographyonline.com/view/monitoring-column-methionine-oxidation-part-system-suitability-test-during-uhplc-msms-peptide-mappin Analytical investigation of forced oxidized anti-VEGF IgG molecules: a focus on the alterations in antigen and receptor binding activities A Parlar , B Gurel , MR Sönmez, M Yuce - Scientia Pharmaceutica, 2023 - mdpi.comhttps://www.mdpi.com/2218-0532/91/3/31 Protein quantification by MALDI-selected reaction monitoring mass spectrometry using sulfonate derivatized peptides A Lesur , E Varesio, G Hopfgartner - Analytical chemistry, 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac100602d In-vivo characterization of therapeutic antibodies after subcutaneous injection using a LC-MS based immuno-capture assay A Doell - 2019 - scholar.archive.orghttps://scholar.archive.org/work/cgjicy7765fwzo5mj5vt4auba4/access/wayback/https://duepublico2.uni-due.de/servlets/MCRFileNodeServlet/duepublico_derivate_00070596/Diss_Doell.pdf

Peptide H-VYAEVNSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYAEVNSLR-OH include the following: Phosphorylation of Dentin Matrix Protein 1 and Phosphophoryn Y Duan - 2009 - d-scholarship.pitt.eduhttp://d-scholarship.pitt.edu/8916/

Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LDDINPTVLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LDDINPTVLIK-OH include the following: Augmenting anti-tumor immunity by targeting macrophage COX-2 in breast cancer EP Chen - 2014 - search.proquest.comhttps://search.proquest.com/openview/1605fe6fe72f39b4cf94fe35c629bd6b/1?pq-origsite=gscholar&cbl=18750

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP3A4 antibody, catalog no. 70R-7491

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.

Peptide H-KWASLWNWFNITNWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KWASLWNWFNITNWL-OH include the following: The role of proteins in the formation of domains in membranes RM Epand - Protein-Lipid Interactions: New Approaches and , 2006 - Springerhttps://link.springer.com/chapter/10.1007/3-540-28435-4_4

A synthetic peptide for use as a blocking control in assays to test for specificity of FOXN4 antibody, catalog no. 70R-8770

Portion of EBV

Peptide H-AVAVYADQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVAVYADQAK-OH include the following: Cellular Concentrations of the transporters DctA and DcuB and the sensor DcuS of Escherichia coli and the contributions of free and complexed DcuS to S Wörner, K Surmann, A Ebert-Jung - Journal of , 2018 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jb.00612-17

Catalogue peptide; min. 95% purity

Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH include the following: Systematic characterization by mass spectrometric analysis of phosphorylation sites in IRF-3 regulatory domain activated by IKK-i K Fujii, S Nakamura, K Takahashi, F Inagaki - Journal of proteomics, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391910000461 Identification of a novel in vivo virus-targeted phosphorylation site in interferon regulatory factor-3 (IRF3) B Bergstroem , IB Johnsen, TT Nguyen, L Hagen - Journal of biological , 2010 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)66357-8/abstract

Peptide H-VYGFVRACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYGFVRACL-OH include the following: Analysis of HLA-A24-restricted peptides of carcinoembryonic antigen using a novel structure-based peptide-HLA docking algorithm Y Nakamura, S Tai, C Oshita, A Iizuka - Cancer , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1349-7006.2011.01866.x IFN-y enzyme-linked immunospot (ELISPOT) assay ELISPOT assays were performed as described previously Y Nakamoto - mhlw-grants.niph.go.jphttps://mhlw-grants.niph.go.jp/system/files/2011/113111/201125022A/201125022A0019.pdf Development of a novel redirected T-cell-based adoptive immunotherapy targeting human telomerase reverse transcriptase for adult T-cell leukemia Y Miyazaki, H Fujiwara, H Asai, F Ochi - Blood, The Journal , 2013 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/121/24/4894/31637 Alternative approaches to the discovery and development of telomerase-targeted anticancer drugs S Richter , M Palumbo - Mini Reviews in Medicinal Chemistry, 2003 - academia.eduhttps://www.academia.edu/download/37976973/2.pdf Combining three-dimensional modeling with artificial intelligence to increase specificity and precision in peptide-MHC binding predictions MP Aranha , YSM Jewel , RA Beckman - The Journal of , 2020 - journals.aai.orghttps://journals.aai.org/jimmunol/article/205/7/1962/107956 hTERT-based therapy: a universal anticancer approach MH Lu, ZL Liao, XY Zhao, YH Fan - Oncology , 2012 - spandidos-publications.comhttps://www.spandidos-publications.com/or/28/6/1945 Safety and long-term outcome of intratumoral injection of OK432-stimulated dendritic cells for hepatocellular carcinomas after radiofrequency ablation M Kitahara, E Mizukoshi, T Terashima - Translational , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1936523319305388 Charge-based interactions through peptide position 4 drive diversity of antigen presentation by human leukocyte antigen class I molecules KR Jackson, DA Antunes , AH Talukder, AR Maleki - PNAS , 2022 - academic.oup.comhttps://academic.oup.com/pnasnexus/article-abstract/1/3/pgac124/6650681 Identification of human telomerase reverse transcriptase-derived peptides that induce HLA-A24-restricted antileukemia cytotoxic T lymphocytes J Arai, M Yasukawa , H Ohminami - Blood, The Journal , 2001 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/97/9/2903/130348 Human Telomerase Reverse Transcriptase-specific T-Cell Receptor Gene Transfer Redirects T Cells to Display an Effective Antitumor Reactivity Against H Fujiwara, F Ochi, Y Miyazaki, H Asai, T Ishida - Blood, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006497118545869 Vaccines as consolidation therapy for myeloid leukemia G Alatrash , JJ Molldrem - Expert review of hematology, 2011 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1586/ehm.10.80 Tumor-associated antigens G Alatrash , AK Crain, JJ Molldrem - Immune biology of allogeneic , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780128126301000074 Novel Small-Molecule TOP2 Catalytic Inhibitor EC Gunther, DJ Stone, RW Gerwien, P Bento - Biochim. Biophys - mhlw-grants.niph.go.jphttps://mhlw-grants.niph.go.jp/system/files/2011/112042/201113009A/201113009A0017.pdf Enhancement of tumor-specific T-cell responses by transcatheter arterial embolization with dendritic cell infusion for hepatocellular carcinoma E Mizukoshi, Y Nakamoto, K Arai - journal of cancer, 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.24882 Crystal structure of HLA-A* 2402 complexed with a telomerase peptide DK Cole , PJ Rizkallah , F Gao, NI Watson - European journal of , 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200535424 The emerging factors and treatment options for NAFLD-related hepatocellular carcinoma C Zhang , M Yang - Cancers, 2021 - mdpi.comhttps://www.mdpi.com/2072-6694/13/15/3740 Recent patents on anti-telomerase cancer therapy A Agrawal , S Dang , R Gabrani - Recent patents on anti-cancer , 2012 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/pra/2012/00000007/00000001/art00008

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of RERG antibody, catalog no. 70R-9847

Histone acetyltransferase 1 (HAT1) is a protein that transfers an acetyl group to histones. It is mainly found in the nucleus and is involved in gene regulation. HAT1 interacts with many other proteins such as receptors, peptides, activators, and ion channels. The recombinant form of this enzyme has been shown to be a potent inhibitor of L-type calcium channels, which are important for the transmission of nerve impulses. This enzyme also inhibits glutamate receptors and can affect the activation of phospholipase C. HAT1 has also been shown to inhibit various types of cancers by suppressing tumor growth and invasion.

Peptide H-QGSVQPQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QGSVQPQQL-OH include the following: HLA-DQ molecules as affinity matrix for identification of gluten T cell epitopes S Dorum, M Bodd, LE Fallang, E Bergseng - The Journal of , 2014 - journals.aai.orghttps://journals.aai.org/jimmunol/article/193/9/4497/98312 Impacts of Sourdough Technology on the Availability of Celiac Peptides from Wheat alpha-and γ-Gliadins: In Silico Approach A Barre, H Benoist, P Rouge - Allergies, 2023 - mdpi.comhttps://www.mdpi.com/2313-5786/3/1/4

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ44894 antibody, catalog no. 70R-8899

Ac-Tyr-OEt • H2O is a peptide with biological properties. It is used as a signal peptide, which is a short sequence of amino acids that directs the protein to the endoplasmic reticulum. Ac-Tyr-OEt • H2O has been shown to have colony stimulating factor activity and can be used in the treatment of diseases such as anemia and cancer. The solid state structure of Ac-Tyr-OEt • H2O was determined by X-ray crystallography and found to be a dimer with two molecules bound together through hydrogen bonding. This peptide interacts with enzymes in the proteolytic pathway, inhibiting their ability to function. Ac-Tyr-OEt • H2O also has inhibitory properties against transfer reactions, which are reactions in which one molecule transfers a part of its chemical group or atoms from one molecule to another. Ac-Tyr-OEt •

Peptide H-NANPDCKTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NANPDCKTI-OH include the following: Impaired processing and presentation of cytotoxic-T-lymphocyte (CTL) epitopes are major escape mechanisms from CTL immune pressure in human Y Yokomaku, H Miura, H Tomiyama - Journal of , 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.78.3.1324-1332.2004 Impaired Processing and Presentation of Y Nagai, A Iwamoto, Z Matsuda, K Kawana-Tachikawa - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=bc47ee39b1fdce484b73e5372209917737d691a6 Longitudinal analysis of an HLA-B* 51-restricted epitope in integrase reveals immune escape in early HIV-1 infection N Yager, N Robinson, H Brown, P Flanagan , J Frater - AIDS, 2013 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/2013/01280/longitudinal_analysis_of_an_hla_b_51_restricted.2.aspx Similar HIV-1 evolution and immunological responses at 10 years despite several therapeutic strategies and host HLA Types M Arnedo-Valero, M Plana, A Mas - Journal of medical , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jmv.20117 Variable fate of virus-specific CD4+ T cells during primary HIV-1 infection A Oxenius , S Fidler , M Brady - European journal of , 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1521-4141(200112)31:12%3C3782::AID-IMMU3782%3E3.0.CO;2-%23

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT2B antibody, catalog no. 70R-2239

Peptide H-NGFYPATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NGFYPATR-OH include the following: Complement Factor H Displays Opposite Expression Patterns Under Two Situations of Methamphetamine Administration: Acute Exposure and Chronic Dependence M Lin, J Xu, Z Liu, L Qin, X Wang, X Pu - Neuroscience Bulletin, 2020 - Springerhttps://link.springer.com/article/10.1007/s12264-020-00576-6

This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the (Sulfocyanine7) fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.This peptide contains Sulfocyanine7, which is a NIR (near infrared) emitting fluorescent dye.

Peptide H-QIFNKPYWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QIFNKPYWL-OH include the following: Enhancement of humoral and cell mediated immune response to HPV16 L1-derived peptides subsequent to vaccination with prophylactic bivalent HPV L1 virus-like M Yokomine, S Matsueda - Experimental and ..., 2017 - spandidos-publications.comhttps://www.spandidos-publications.com/10.3892/etm.2017.4150 Identification of B cell epitopes reactive to human papillomavirus type-16L1-derived peptides A Fukui, S Matsueda , K Kawano, N Tsuda, N Komatsu- Virology journal, 2012 - Springerhttps://link.springer.com/article/10.1186/1743-422X-9-199

Peptide H-VTEEELMTPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VTEEELMTPK-OH include the following: Absolute quantitation of human wild-type DNAI1 protein in lung tissue using a nanoLC-PRM-MS-based targeted proteomics approach coupled with H Wang, X Ni, N Clark, K Randall, L Boeglin - Clinical Proteomics, 2024 - Springerhttps://link.springer.com/article/10.1186/s12014-024-09453-0

A synthetic peptide for use as a blocking control in assays to test for specificity of HSFY2 antibody, catalog no. 20R-1152

A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf180 antibody, catalog no. 70R-6588

Peptide H-CLQAGASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CLQAGASQ-OH include the following: Residual enzymatic activity of the tetanus toxin light chain present in tetanus toxoid batches used for vaccine production HA Behrensdorf-Nicol, B Kegel, U Bonifas - Vaccine, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X08005859 An in vitro assay for detection of tetanus neurotoxin activity: Using antibodies for recognizing the proteolytically generated cleavage product B Kegel, HA Behrensdorf-Nicol, U Bonifas - Toxicology in Vitro, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0887233307001877

A synthetic peptide for use as a blocking control in assays to test for specificity of LST-3TM12 antibody, catalog no. 70R-6339

Peptide H-LAAFPEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LAAFPEDR-OH include the following: Immunoaffinity microflow liquid chromatography/tandem mass spectrometry for the quantitation of PD1 and PD-L1 in human tumor tissues Y Zhu, J Zalaznick, B Sleczka, K Parrish - Rapid , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.8896 Multiplex Immuno-Liquid Chromatography-Mass Spectrometry-Parallel Reaction Monitoring (LC-MS-PRM) Quantitation of CD8A, CD4, LAG3, PD1, PD-L1, and PD Q Zhang , R Salzler, A Dore, J Yang , D Ma - Journal of proteome , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.8b00605 Antipeptide immunocapture with in-sample calibration curve strategy for sensitive and robust LC-MS/MS bioanalysis of clinical protein biomarkers in formalin-fixed N Zheng , K Taylor, H Gu , R Santockyte - Analytical , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.0c03271 In-Sample Calibration Curve (ISCC) Using Multiple Isotopologue Reaction Monitoring (MIRM) of a Stable Isotopically Labeled Analyte for Instant LC-MS/MS H Gu , Y Zhao, M DeMichele, N Zheng , YJ Zhang - pstorage-acs-6854636.s3 http://pstorage-acs-6854636.s3.amazonaws.com/14143646/ac8b05656_si_001.pdf

Catalogue peptide; min. 95% purity

Peptide H-TTPESANL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TTPESANL-OH include the following: A novel chimeric Rev, Tat, and Nef (Retanef) antigen as a component of an SIV/HIV vaccine Z Hel , JM Johnson, E Tryniszewska, WP Tsai, R Harrod - Vaccine, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X0200258X Structural immunology and crystallography help immunologists see the immune system in action: how T and NK cells touch their ligands Y Chen, Y Shi, H Cheng, YQ An, GF Gao - IUBMB life, 2009 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1002/iub.208 Tat-specific cytotoxic T lymphocytes select for SIV escape variants during resolution of primary viraemia TM Allen , DH O'Connor , P Jing, JL Dzuris, BR Mothe - Nature, 2000 - nature.comhttps://www.nature.com/articles/35030124 CD8+ Lymphocytes from Simian Immunodeficiency Virus-Infected Rhesus Macaques Recognize 14 Different Epitopes Bound by the Major Histocompatibility TM Allen , BR Mothé, J Sidney , P Jing, JL Dzuris - Journal of , 2001 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.75.2.738-749.2001 Preferential selection of viral escape mutants by CD8+ T cell 'sieving' of SIV reactivation from latency SS Docken , K McCormick, MB Pampena - Plos , 2023 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1011755 Potent simian immunodeficiency virus-specific cellular immune responses in the breast milk of simian immunodeficiency virus-infected, lactating rhesus monkeys SR Permar , HH Kang , A Carville - The Journal of , 2008 - journals.aai.orghttps://journals.aai.org/jimmunol/article/181/5/3643/80579 Structural determinants of T-cell receptor bias in immunity SJ Turner , PC Doherty , J McCluskey - Nature reviews , 2006 - nature.comhttps://www.nature.com/articles/nri1977 Functional implications of T cell receptor diversity SJ Turner , NL La Gruta , K Kedzierska - Current opinion in , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S095279150900082X SIV-specific CD8+ T-cells express high levels of PD1 and cytokines but have SHM Douek, SJ Davis , G Franchini, RA Koup - academia.eduhttps://www.academia.edu/download/42793469/SIV-specific_CD8_T_cells_express_high_20160218-4843-s96nlw.pdf Immunodomination in the evolution of dominant epitope-specific CD8+ T lymphocyte responses in simian immunodeficiency virus-infected rhesus monkeys MH Newberg, KJ McEvers, DA Gorgone - The Journal of , 2006 - journals.aai.orghttps://journals.aai.org/jimmunol/article/176/1/319/75192 T Cells to+ Contribution of CD8 IVI Rhesus - JOURNAL OF VIROLOGY, 2008 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=d4986db645d4a06e40bd39e1b21b2454c4d60a26 First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A* 01 complexed with two immunogenic SIV epitopes and F Chu , Z Lou, YW Chen , Y Liu, B Gao - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/178/2/944/37482 Contribution of CD8+ T Cells to Containment of Viral Replication and Emergence of Mutations in Mamu-A*01-Restricted Epitopes in Simian Immunodeficiency Virus EY Kim , RS Veazey , R Zahn , KJ McEvers - Journal of , 2008 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.02749-07 Collapse of cytolytic potential in SIV-specific CD8+ T cells following acute SIV infection in rhesus macaques ER Roberts, DG Carnathan, H Li, GM Shaw - PLoS , 2016 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1006135 T cell receptor recognition motifs govern immune escape patterns in acute SIV infection DA Price, SM West, MR Betts , LE Ruff, JM Brenchley - Immunity, 2004 - cell.comhttps://www.cell.com/fulltext/S1074-7613(04)00314-0?large_figure=true TCR Affinity Associated with Functional Differences between Dominant and Subdominant SIV Epitope-Specific CD8+ T Cells in Mamu-A*01+ Rhesus Monkeys CE Osuna, AM Gonzalez, HH Chang , AS Hung - PLoS , 2014 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1004069 SIV-specific CD8+ T cells express high levels of PD1 and cytokines but have impaired proliferative capacity in acute and chronic SIVmac251 infection C Petrovas , DA Price, J Mattapallil - Blood, The Journal , 2007 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/110/3/928/132009

H-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is an acid-labile thiolated polystyrene resin with a low degree of substitution. The resin has been shown to be stable in the presence of strong acid, and can be used for the synthesis of peptides. This product contains 1% DVB as a protective colloid, which resists hydrolysis by acids and bases.

A synthetic peptide for use as a blocking control in assays to test for specificity of GGN antibody, catalog no. 70R-2174

A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6276

Peptide H-GLPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLPAPIEK^-OH include the following: An Adaptable Antibody-Based Platform for Flexible Synthetic Peptide Delivery Built on Agonistic CD40 Antibodies M Eltahir, I Lauren, M Lord , A Chourlia - Advanced , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adtp.202200008 Quantitative proteomic analysis of human Epithelial Lining Fluid by microfluidics-based nanoLC-MS/MS: a feasibility study L Franciosi, N Govorukhina, F Fusetti, B Poolman - and application of - core.ac.ukhttps://core.ac.uk/download/pdf/148312873.pdf#page=40 Immunoglobulin G Fc N-glycan profiling in patients with gastric cancer by LC-ESI-MS: relation to tumor progression and survival K Kodar , J Stadlmann , K Klaamas , B Sergeyev - Glycoconjugate , 2012 - Springerhttps://link.springer.com/article/10.1007/s10719-011-9364-z An automated mass spectrometric blood test for therapeutic drug monitoring of infliximab JG van der Gugten , B Bressler, ML DeMarco - Clinical Mass Spectrometry, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2376999818300291 Assessment of naturally occurring covalent and total dimer levels in human IgG1 and IgG2 J Yang, AM Goetze, GC Flynn - Molecular immunology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589013005610 A close look at human IgG sialylation and subclass distribution after lectin fractionation J Stadlmann , A Weber, M Pabst , H Anderle - , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200800931 Absolute and multiplex quantification of antibodies in serum using PSAQ™standards and LC-MS/MS D Lebert, G Picard, C Beau-Larvor, L Troncy - Bioanalysis, 2015 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.56 Affinity of IgE and IgG against cross-reactive carbohydrate determinants on plant and insect glycoproteins C Jin , B Hantusch , W Hemmer, J Stadlmann - Journal of Allergy and , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674907014480

A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6725

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71B antibody, catalog no. 70R-4139

Peptide H-NTQPIMDTDGSYFVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NTQPIMDTDGSYFVYSK-OH include the following: Orthogonal Approaches for the Analysis of Protein Sequence and Post Translational Modifications of a Monoclonal Antibody MN Michael, D Neville , P Kuhlman, LP Liew, L Royle - stem-art.comhttp://www.stem-art.com/Library/Miscellaneous/Orthogonal%20Apporaches%20for%20the%20Analysis%20of%20Protein%20Sequence%20White%20Paper%20Final%20Version.pdf

Peptide H-LSGLLDLALGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSGLLDLALGK-OH include the following: Interferon-γ induces immunoproteasomes and the presentation of MHC I-associated peptides on human salivary gland cells ME Arellano-Garcia, K Misuno, SD Tran , S Hu - PloS one, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0102878 Interferon-c Induces Immunoproteasomes and the Presentation of MHC I-Associated Peptides on ME Arellano-Garcia, K Misuno, SD Tran , S Hu - 2014 - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/929b/8ce8ee05a928f2f32216949b73106b36fe53.pdf Mass spectrometry-based proteomics for the forensic identification of vomit traces M Pieri , A Silvestre, M De Cicco, G Mamone - Journal of , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391919302969 Developmental validation of a multiplex proteomic assay for the identification of forensically relevant biological fluids HE McKiernan, PB Danielson , CO Brown - Forensic Science , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0379073821002280 Targeted-Ion Mass Spectrometry for the Identification of Forensically Relevant Biological Fluids and Samples from Sexual Assault Evidence HE McKiernan - 2019 - search.proquest.comhttps://search.proquest.com/openview/6f4ff76624bebedf84a40b036510479f/1?pq-origsite=gscholar&cbl=18750&diss=y

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF21A antibody, catalog no. 70R-5567

A synthetic peptide for use as a blocking control in assays to test for specificity of GRIN2B antibody, catalog no. 70R-5195

Ac-Leu-Leu-Met-H (Aldehyde) is a tetrazolium dye that is used as a biological stain for the detection of bacteria in infectious diseases. It binds to toll-like receptor 4 on macrophages and other cells, which triggers a cascade of events leading to bacterial cell lysis. Aldehyde also has been shown to be an autophagy inducer and can cause neuronal death when administered in high doses.

Peptide H-VYKSPVVSGDTSPRHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYKSPVVSGDTSPRHL-OH include the following: Cyclization Scaffolding for Improved Vaccine Immunogen Stability: Application to Tau Protein in Alzheimer's Disease SCC Hsueh , M Nijland, A Aina - Journal of Chemical , 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jcim.3c01556

FLAG peptide: 8-amino-acid sequence for recombinant protein purification with enterokinase-cleavage.

Peptide H-YFIASFRLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YFIASFRLF-OH include the following: Whole proteome screening and identification of potential epitopes of SARS-CoV-2 for vaccine design-an immunoinformatic, molecular docking and molecular MMA Ezaj , M Junaid , Y Akter , A Nahrin - Journal of , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2021.1886171 Improved predictions of antigen presentation and TCR recognition with MixMHCpred2. 2 and PRIME2. 0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes D Gfeller , J Schmidt, G Croce , P Guillaume, S Bobisse - Cell Systems, 2023 - cell.comhttps://www.cell.com/cell-systems/pdf/S2405-4712(22)00470-7.pdf Predictions of immunogenicity reveal potent SARS-CoV-2 CD8+ T-cell epitopes D Gfeller , J Schmidt, G Croce , P Guillaume, S Bobisse - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.05.23.492800.abstract

Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-V^YIHPF-OH include the following: Mass spectrometry of peptides and proteins using digestion by a grape cysteine protease at pH 3 Z Perutka, M Å ebela - Journal of mass spectrometry, 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4444 Integrating computational modeling and experimental assay to discover new potent ACE-inhibitory peptides Y Ren, Q Wang, S Chen, H Cao - Molecular Informatics, 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/minf.201300131 The specific isolation of C-terminal peptides of proteins through a transamination reaction and its advantage for introducing functional groups into the peptide K Sonomura, H Kuyama , E Matsuo - Journal Devoted to , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3920 Fragmentation mechanisms of oxidized peptides elucidated by SID, RRKM modeling, and molecular dynamics JM Spraggins , JA Lloyd, MV Johnston , J Laskin - Journal of the American , 2009 - Springerhttps://link.springer.com/article/10.1016/j.jasms.2009.04.012 Structure-activity study of LVV-hemorphin-7: angiotensin AT4 receptor ligand and inhibitor of insulin-regulated aminopeptidase J Lee , T Mustafa, SG McDowall - of Pharmacology and , 2003 - ASPEThttps://jpet.aspetjournals.org/content/305/1/205.short A mechanistic investigation of the enhanced cleavage at histidine in the gas-phase dissociation of protonated peptides G Tsaprailis, H Nair, W Zhong , K Kuppannan - Analytical , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac034971j Biological Studies of Angiotensin II Analogs Using Nanostructured Micelles CN Pedron , DR Araacaºjo , VX Oliveira Jr - researchgate.nethttps://www.researchgate.net/profile/Daniele-De-Araujo/publication/299872826_Biological_Studies_of_Angiotensin_II_Analogs_Using_Nanostructured_Micelles/links/571e189a08aeaced7889d8aa/Biological-Studies-of-Angiotensin-II-Analogs-Using-Nanostructured-Micelles.pdf Study of secondary specificity of enteropeptidase in comparison with trypsin AG Mikhailova, VV Likhareva, BV Vaskovsky - Biochemistry , 2004 - Springerhttps://link.springer.com/article/10.1023/B:BIRY.0000040224.47278.3b

Tertiapin-Q is a bee toxin derivative that inhibits BK-type K(+) channels in a concentration-dependent manner, inhibiting efflux to K(+).

CoV-2 S1 (319-529) is a recombinant peptide that was derived from the CoV-2 S1 protein. It is an activator of ion channels and can be used as a research tool in pharmacology and cell biology. This peptide has been shown to bind to the Na+ channel, which is involved in the generation and propagation of nerve impulses, and to modulate its gating properties. It can also inhibit voltage-gated K+ channels, which are involved in the regulation of neuron excitability. CoV-2 S1 (319-529) is purified at > 98% purity and has a CAS number.

Duck liver-derived peptide 4 is a bioactive peptide with high antioxidant activity. The antioxidant activity is attributed to forming hydrogen bonds between their amino acid residues and free radical molecules. Duck liver-derived peptide 4 increases the activities and mRNA expression levels of intracellular antioxidant enzymes (SOD, CAT, and GSH-Px) in HepG2 oxidative damage cell models. Duck liver-derived peptide 4 can reduce the content of malondialdehyde (MDA) and reactive oxygen species (ROS) accumulation, thereby inhibiting intracellular oxidative damage. Duck liver-derived peptide 4 has the following activity: ACE inhibitor, dipeptidyl peptidase IV inhibitor, antioxidant, and antithrombotic. It may be used in the research for food-derived bioactive peptides for modified-food development.

LCMV gp33-41 acetate is a sequence of lymphocytic choriomeningitis virus which restricted by major histocompatibility complex class I H-2Db and presented to

Peptide H-VLNDINQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VLNDINQAK-OH include the following: CROT (carnitine O-octanoyltransferase) is a novel contributing factor in vascular calcification via promoting fatty acid metabolism and mitochondrial dysfunction T Okui, M Iwashita, MA Rogers , A Halu - , and vascular biology, 2021 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/ATVBAHA.120.315007

Peptide H-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PKPPKPVSKMRMATPLLMQA-OH include the following: Autoreactive T cell responses show proinflammatory polarization in diabetes but a regulatory phenotype in health S Arif, TI Tree , TP Astill, JM Tremble - The Journal of , 2004 - Am Soc Clin Investighttps://www.jci.org/articles/view/19585 HLA-DP2: self peptide sequences and binding properties. RM Chicz, DF Graziano, M Trucco - (Baltimore, Md.: 1950 , 1997 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/159/10/4935/30560 HLA Class II molecules on haplotypes associated with type 1 diabetes exhibit similar patterns of binding affinities for coxsackievirus P2C peptides RJ Ellis , R Varela-Calvino , TIM Tree - Immunology, 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2567.2005.02233.x Beryllium binding to HLA-DP molecule carrying the marker of susceptibility to berylliosis glutamate beta69 M Amicosante , N Sanarico, F Berretta, J Arroyo - Human immunology, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0198885901002610 Reconstruction of a pathway of antigen processing and class II MHC peptide capture CX Moss, TI Tree , C Watts - The EMBO Journal, 2007 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/sj.emboj.7601660 DRB1* 01-DR1, DR103 AANA NA - The HLA FactsBook, 1999 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=ZmZYk2FQiuUC&oi=fnd&pg=PA331&dq=(%22PKPPKPVSKMRMATPLLMQA%22+OR+%22H-PKPPKPVSKMRMATPLLMQA-OH%22+OR+%22NH2-Pro-Lys-Pro-Pro-Lys-Pro-Val-Ser-Lys-Met-Arg-Met-Ala-Thr-Pro-Leu-Leu-Met-Gln-Ala-OH%22)+AND+peptide&ots=aAMyvUP-qH&sig=_h8JCpcLIV9BNB2spWjLFIUvM28

Peptide H-LVLVNAIYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LNVQGDTK^-OH include the following: Rapid polysorbate 80 degradation by liver carboxylesterase in a monoclonal antibody formulated drug substance at early stage development S Zhang , H Xiao, R Molden, H Qiu, N Li - Journal of Pharmaceutical , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354920303841

Peptide Cyc-H-LRRFSTMPFMFCNINNVCNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Cyc-H-LRRFSTMPFMFCNINNVCNF-NH2 include the following: Extracellular matrix glycoprotein-derived synthetic peptides differentially modulate glioma and sarcoma cell migration N Brösicke, M Sallouh, LM Prior, A Job - Cellular and molecular , 2015 - Springerhttps://link.springer.com/article/10.1007/s10571-015-0170-1 Peptides derived from type IV collagen, CXC chemokines, and thrombospondin-1 domain-containing proteins inhibit neovascularization and suppress tumor growth in JE Koskimaki, ED Karagiannis , EV Rosca , F Vesuna - Neoplasia, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1476558609800973 Pentastatin-1, a collagen IV derived 20-mer peptide, suppresses tumor growth in a small cell lung cancer xenograft model JE Koskimaki, ED Karagiannis , BC Tang , H Hammers - BMC cancer, 2010 - Springerhttps://link.springer.com/article/10.1186/1471-2407-10-29 Synergy between a collagen IV mimetic peptide and a somatotropin-domain derived peptide as angiogenesis and lymphangiogenesis inhibitors JE Koskimaki, E Lee , W Chen , CG Rivera , EV Rosca - Angiogenesis, 2013 - Springerhttps://link.springer.com/article/10.1007/s10456-012-9308-7 Structure-Activity Relationship Study of Collagen-Derived Anti-Angiogenic Biomimetic Peptides EV Rosca , JE Koskimaki, NB Pandey - Chemical biology & , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1747-0285.2012.01376.x Collagen IV and CXC chemokine-derived antiangiogenic peptides suppress glioma xenograft growth EV Rosca , B Lal , JE Koskimaki, AS Popel - Anti-cancer , 2012 - journals.lww.comhttps://journals.lww.com/anti-cancerdrugs/FullText/2012/08000/Collagen_IV_and_CXC_chemokine_derived.5.aspx

B8R (20-27) is derived from the B8R protein, a virulence factor of the poxvirus. Due to B8R being a homolog of the extracellular domain of the IFN- γ receptor, B8R can bind to and prevent IFN- γ from binding to its receptor. IFN- γ has antiviral activity against encephalomyocarditis virus and the vesicular stomatitis virus is inhibited when B8R is expressed.

A synthetic peptide for use as a blocking control in assays to test for specificity of RELB antibody, catalog no. 20R-1183

A synthetic peptide for use as a blocking control in assays to test for specificity of AMBP antibody, catalog no. 70R-9689

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf91 antibody, catalog no. 70R-3475

Bekm 1 is a peptide that binds to the nicotinic acetylcholine receptor and activates it. This receptor is found on the post-synaptic membrane of neurons, which are responsible for transmitting messages from one nerve cell to another. Bekm 1 is an agonist at this receptor, which means that it binds to the receptor and triggers a response. The activation of these receptors has been shown to inhibit neuronal activity.

Peptide H-LVVKNPAAHHAIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LVVKNPAAHHAIS-OH include the following: Vaccines against candidiasis: Status, challenges and emerging opportunity SR Sahu , S Bose, M Singh , P Kumari - Frontiers in Cellular , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fcimb.2022.1002406/full Calnexin induces expansion of antigen-specific CD4+ T cells that confer immunity to fungal ascomycetes via conserved epitopes M Wuthrich, TT Brandhorst, TD Sullivan, H Filutowicz - Cell host & , 2015 - cell.comhttps://www.cell.com/cell-host-microbe/pdf/S1931-3128(15)00066-9.pdf Advances in fungal peptide vaccines L BR Da Silva, C P. Taborda , J D. Nosanchuk - Journal of fungi, 2020 - mdpi.comhttps://www.mdpi.com/2309-608X/6/3/119

Peptide H-THPHFVIPYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-THPHFVIPYR^-OH include the following: Detection of proteolytic signatures for Parkinson's disease PL Jordal, TF Dyrlund , K Winge , MR Larsen - Future , 2016 - Future Medicinehttps://www.futuremedicine.com/doi/abs/10.2217/fnl.16.3 Association of cortical beta-amyloid protein in the absence of insoluble deposits with Alzheimer disease L Yu , VA Petyuk , S Tasaki , PA Boyle , C Gaiteri - JAMA , 2019 - jamanetwork.comhttps://jamanetwork.com/journals/jamaneurology/article-abstract/2731441 Strategies for examination of Alzheimer's disease amyloid precursor protein isoforms JRA Newton, D Parkinson, MR Clench - Analytical and bioanalytical , 2006 - Springerhttps://link.springer.com/article/10.1007/s00216-006-0462-x

Portion of EBV EBNA 3

Catalogue peptide; min. 95% purity

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-YVEQQYGQPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YVEQQYGQPSSK^-OH include the following: Interindividual variability in hepatic organic anion-transporting polypeptides and P-glycoprotein (ABCB1) protein expression: quantification by liquid chromatography B Prasad , R Evers , A Gupta , CECA Hop - Drug Metabolism and , 2014 - ASPEThttps://dmd.aspetjournals.org/content/42/1/78.short

A synthetic peptide for use as a blocking control in assays to test for specificity of RRM1 antibody, catalog no. 70R-1618

Peptide H-NSFEVHVCACPGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NSFEVHVCACPGR-OH include the following: Comprehensive detection of single amino acid variants and evaluation of their deleterious potential in a PANC-1 cell line Z Tan, J Zhu, PM Stemmer , L Sun, Z Yang - Journal of proteome , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.9b00840 APR-246 reactivates mutant p53 by targeting cysteines 124 and 277 Q Zhang, VJN Bykov , KG Wiman - Cell death & , 2018 - nature.comhttps://www.nature.com/articles/s41419-018-0463-7

Peptide H-SVINDPIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SVINDPIYK-OH include the following: Integration of mechanisms affecting the activity of drug metabolizing enzymes and transporters to predict variability in oral drug absorption S Sharma - 2023 - search.proquest.comhttps://search.proquest.com/openview/9ab548669e53da4edbb2bf4277f1d6b4/1?pq-origsite=gscholar&cbl=18750&diss=y Label-free absolute protein quantification with data-independent acquisition B He , J Shi , X Wang , H Jiang , HJ Zhu - Journal of proteomics, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391919300867

A synthetic peptide for use as a blocking control in assays to test for specificity of SSB antibody, catalog no. 70R-4891

Peptide H-ALVEICTEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALVEICTEM-OH include the following: Positioning of APOBEC3G/F Mutational Hotspots in the Human Immunodeficiency Virus Genome Favors Reduced Recognition by CD8+ T Cells M Monajemi, CF Woodworth, K Zipperlen, M Gallant - PLoS , 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0093428 Novel role of APOBEC3G/F enzymes in adaptive immunity M Monajemi - 2012 - research.library.mun.cahttps://research.library.mun.ca/11065/ Sequential broadening of CTL responses in early HIV-1 infection is associated with viral escape AC Karlsson , AKN Iversen, JM Chapman, T de Oliveira - PloS one, 2007 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0000225

Peptide LCBiot-RRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-RRRRRRRRR-OH include the following: Optimization of inhibitory peptides targeting phosphoprotein of rabies virus Y Lu, L Cheng, J Liu - International Journal of Peptide Research and , 2020 - Springerhttps://link.springer.com/article/10.1007/s10989-019-09906-3 Bio-orthogonal engineered peptide: A multi-functional strategy for the gene therapy of osteoporotic bone loss W Wang , Q Wang, L Yu , G Ge, X Liu, A Gao, G Wang - Biomaterials, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961223003605 Charge type, charge spacing, and hydrophobicity of arginine-rich cell-penetrating peptides dictate gene transfection NA Alhakamy , P Dhar , CJ Berkland - Molecular pharmaceutics, 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.molpharmaceut.5b00871 Discovery of membrane-permeating cyclic peptides via mRNA display J Bowen, AE Schloop, GT Reeves - Bioconjugate , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.bioconjchem.0c00413 Anti-inflammatory activity of superoxide dismutase mimics functionalized with cell-penetrating peptides E Mathieu, AS Bernard, HYV Ching , A Somogyi - Dalton , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/dt/c9dt04619d Target delivery of a gene into the brain using the RVG29-oligoarginine peptide C Gong, X Li, L Xu, YH Zhang - Biomaterials, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961211014724 Selective DNA delivery to tumor cells using an oligoarginine-LTVSPWY peptide C Gong, D Pan, F Qiu, P Sun, YH Zhang - PLoS One, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0110632 Poly-arginine and arginine-rich peptides are neuroprotective in stroke models BP Meloni , LM Brookes, VW Clark - Journal of Cerebral , 2015 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1038/jcbfm.2015.11 Membrane interactions of two arginine-rich peptides with different cell internalization capacities A Walrant, A Vogel, I Correia, O Lequin - et Biophysica Acta (BBA , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273612000752

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23A antibody, catalog no. 70R-1037

Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EQLTPLIK^-OH include the following: On-column trypsin digestion coupled with LC-MS/MS for quantification of apolipoproteins CA Toth, Z Kuklenyik, JI Jones, BA Parks - Journal of , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391916304225 Individual glycation sites as biomarkers of type 2 diabetes mellitus A Soboleva, N Vashurina, A Frolov - Type, 2021 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=87dFEAAAQBAJ&oi=fnd&pg=PA63&dq=(%22EQLTPLIK%22+OR+%22NH2-Glu-Gln-Leu-Thr-Pro-Leu-Ile-Lys%5E-OH%22+OR+%22H-EQLTPLIK%5E-OH%22+OR+%22H-EQLTPLIK-OH%22+OR+%22EQLTPLIK%5E%22)+AND+peptide&ots=B0IVtanzfk&sig=hC_7AUNdop9io6SqikjUVbnS4u4 Individual glycation sites as biomarkers of type 2 diabetes mellitus A Soboleva, N Vashurina, A Frolov - Type, 2021 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=87dFEAAAQBAJ&oi=fnd&pg=PA63&dq=(%22EQLTPLIK%22+OR+%22NH2-Glu-Gln-Leu-Thr-Pro-Leu-Ile-Lys%5E-OH%22+OR+%22H-EQLTPLIK%5E-OH%22+OR+%22H-EQLTPLIK-OH%22+OR+%22EQLTPLIK%5E%22)+AND+peptide&ots=B0IVtanzim&sig=If2C0CG4XZvmAAnFCIDnCSEhzBc

Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

GP(33-41) is a 9-amino acid lymphocytic choriomeningitis virus epitope; it increases H-2Db on RMA-S at 344 nM SC50 and activates P14 TCR-mouse CD8 T cells.

N-terminal peptide of Annexin I; inhibits leukocyte movement, binds FPR1, stimulates neutrophil NADPH oxidase.

Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-APGLTQALNTK^-OH include the following: Apolipoprotein A1-unique peptide as a diagnostic biomarker for acute ischemic stroke X Zhao , Y Yu, W Xu, L Dong, Y Wang, B Gao - International journal of , 2016 - mdpi.comhttps://www.mdpi.com/1422-0067/17/4/458 Serum level of transferrin unique peptide is decreased in patients with acute ischemic stroke X Hu, Y Li , P Cheng, A Wu, G Li - Frontiers in Neurology, 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fneur.2021.619310/full Identification of site-specific stroke biomarker candidates by laser capture microdissection and labeled reference peptide T Lian, D Qu, X Zhao , L Yu, B Gao - International journal of molecular , 2015 - mdpi.comhttps://www.mdpi.com/1422-0067/16/6/13427 MaRiMba: a software application for spectral library-based MRM transition list assembly CA Sherwood , A Eastham, LW Lee - Journal of proteome , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr900010h