Prodotti biochimici e reagenti

Ac-ERQRRNELARSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNELARSFFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNELARSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNELARSFFALRDQI-OH at the technical inquiry form on this page

Peptide H-NLLSVAYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NLLSVAYK-OH include the following: Targeted proteomics strategy applied to biomarker evaluation YJ Kim, S Gallien, J van Oostrum - PROTEOMICS-Clinical , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201300070 Quantitative proteomes and in vivo secretomes of progressive and regressive UV-induced fibrosarcoma tumor cells: Mimicking tumor microenvironment using a Y Shi, CA Elmets, JW Smith, YT Liu, YR Chen - , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200700425 Large-scale analysis of posttranslational modifications in the hippocampus of patients with Alzheimer's disease using pI shift and label-free quantification without T Kang , JH Kim, I Hong , N Park, H Heinsen - Analytical and , 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-7933-2 CSF 14-3-3beta is associated with progressive cognitive decline in Alzheimer's disease Q Qiang, L Skudder-Hill, T Toyota, Z Huang - Brain , 2023 - academic.oup.comhttps://academic.oup.com/braincomms/article-abstract/5/6/fcad312/7441647 A novel thrombin inhibitory peptide discovered from leech using affinity chromatography combined with ultra-high performance liquid chromatography-high resolution Q Huang, Q Gao, X Chai, W Ren, G Zhang - of Chromatography B, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023220303354 The inhibitor protein of phosphorylated nitrate reductase from spinach (Spinacia oleracea) leaves is a 14-3-3 protein M Bachmann, JL Huber, PC Liao, DA Gage - FEBS , 1996 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/0014-5793(96)00478-4 Software tool for visualization and validation of protein turnover rates using heavy water metabolic labeling and LC-MS HM Deberneh, RG Sadygov - International journal of molecular sciences, 2022 - mdpi.comhttps://www.mdpi.com/1422-0067/23/23/14620 Potential prognostic value of CSF-targeted proteomics across the Alzheimer's disease continuum B Xu, Y Ling, L Liu, Y Liu, Y Lin, J Lyu , Y Zhang - BMC geriatrics, 2024 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC11157758/

Mouse monoclonal C20orf43 antibody

HSD17B14 antibody was raised in Rabbit using Human HSD17B14 as the immunogen

High sensitivity HRP microwell liquid substrate (containing TMB)

MDIAIHHPWI RRPFFPFHSP SRLFDQFFGE HLLESDLFPT STSLSPFYLR PPSFLRAPSW FDTGLSEMRL EKDRFSVNLD VKHFSPEELK VKVLGDVIEV HGKHEERQDE HGFISREFHR KYRIPADVDP LTITSSLSSD GVLTVNGPRK QVSGPERTIP ITREEKPAVT AAPKK

Mouse monoclonal CYP2B1 + CYP2B2 antibody

4,4?-Bis(mercaptomethyl)biphenyl

Aluminum stearate is used for waterproofing fabrics and for thickening lubricating oils. It is involved in the preparation of polyamides and thermosetting plastics. It is used as a waterproofing additive in cements and in light-sensitive photographic compositions. It acts as a gelling agent for alkyd paints, as a defoamer for oil drilling fluids and as a retarder for polysulfide dental impression materials. Further, it is used in greases, lubricants, cutting compounds, cosmetics and pharmaceuticals. It serves as a flatting agent, as a defoaming agent in beet sugar and yeast processing. In addition to this, it is used as a water-repellent soap for natural stone surfaces. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

RFP Tag antibody was raised in mouse using RFP from the Discosoma sea anemone N-terminal peptide-KLH conjugates as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ercc1 antibody, catalog no. 70R-9364

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F5 antibody, catalog no. 70R-1798

A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT13 antibody, catalog no. 70R-7449

1-270 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMLS AHWEKKKTSL VELQEQLQQL PALIADLESM TANLTHLEAS FEEVENNLLH LEDLCGQCEL ERCKHMQSQQ LENYKKNKRK ELETFKAELD AEHAQKVLEM EHTQQMKLKE RQKFFEEAFQ QDMEQYLSTG YLQIAERREP IGSMSSMEVN VDMLEQMDLM DISDQEALDV FLNSGGEENT VLSPALGPES STCQNEITLQ VPNPSELRAK PPSSSSTCTD SATRDISEGG ESPVVQSDEE EVQVDTALAT SHTDREATPD GGEDSDS

RU 24213 is an irreversible inhibitor of the dopamine transporter and competitively inhibits binding at the dopamine receptor. It has shown to have interactive effects on locomotor activity with quinpirole, a D2-receptor agonist, as well as with glutamate, a neurotransmitter that plays an important role in brain function. RU 24213 has also been shown to have antagonistic effects at kappa-opioid receptors in rats striata.

A synthetic peptide for use as a blocking control in assays to test for specificity of CLN8 antibody, catalog no. 70R-7114

Rabbit polyclonal IRS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF382 antibody, catalog no. 20R-1228

Magnesium L-aspartate

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Please enquire for more information about CBDA 510 bS including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4644

Influenza B antibody was raised in mouse using nucleoprotein of influenza virus type B as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC7 antibody, catalog no. 70R-10103

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0A1 antibody, catalog no. 70R-6858

Peptide H-LLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLL^-OH include the following: Synthesis of tripeptide amide derivatives and examination of their inhibitory effect on human leukocyte elastase (HLE) Y TSUDA, N TENo, Y OKADA - Chemical and , 1988 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/cpb1958/36/8/36_8_3119/_article/-char/ja/ Crystallographic studies on the binding of selectively deuterated LLD-and LLL-substrate epimers by isopenicillin N synthase W Ge, IJ Clifton, JE Stok, RM Adlington - Biochemical and , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X10012866 The ability of lower peptides to form co-crystals: inclusion compounds of Leu-Leu-Leu tripeptide with pyridine and picolines TJ Burchell, DV Soldatov , GD Enright - CrystEngComm, 2007 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2007/ce/b708695d Gene expression and peptide localization for LH-hCG receptor in porcine small and large luteal cells: possible regulation by opioid peptides T Kaminski , B Gawronska, K Derecka - Journal of Physiology , 2000 - agro.icm.edu.plhttps://agro.icm.edu.pl/agro/element/bwmeta1.element.agro-article-a5150f5d-45f4-4baa-b997-f700dc380ed3 Role of tripeptidyl peptidase II in the processing of Listeria monocytogenes-derived MHC class I-presented antigenic peptides S Grauling-Halama, U Bahr, S Schenk, G Geginat - Microbes and infection, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457909000987 Local effect of glycine substitution in a model helical peptide PC Lyu , PC Wang , MI Liff - Journal of the American , 1991 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/ja00009a052 Interaction of l-leucyl-l-leucyl-l-leucine thin film with water and organic vapors: receptor properties and related morphology MA Ziganshin , IG Efimova - Journal of Peptide , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1431 Thermal analysis of clathrates of tripeptide LLL with organic compounds and water MA Ziganshin , AV Gerasimov , VV Gorbatchuk - Journal of Thermal , 2015 - Springerhttps://link.springer.com/article/10.1007/s10973-014-4279-0 A combination of tri-leucine and angiopep-2 drives a polyanionic polymalic acid nanodrug platform across the blood-brain barrier LL Israel , O Braubach , A Galstyan, A Chiechi - ACS , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsnano.8b06437 Separation of D-amino acid-containing peptide phenylseptin using 3, 3'-phenyl-1, 1'-binaphthyl-18-crown-6-ether columns I Kawamura , B Mijiddorj , Y Kayano, Y Matsuo - et Biophysica Acta (BBA , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570963920300765 In vitro and in vivo activity of antimicrobial peptides synthesized based on the insect defensin H Saido-Sakanaka, J Ishibashi, E Momotani, F Amano - Peptides, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978103004236 Inhibition of rat liver cathepsins B and L by the peptide aldehyde benzyloxycarbonyl-leucyl-leucyl-leucinal and its analogues H Ito, M Watanabe, YT Kim - Journal of enzyme , 2009 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/14756360802166921 The optimization of polymalic acid peptide copolymers for endosomolytic drug delivery H Ding, J Portilla-Arias, R Patil , KL Black , JY Ljubimova - Biomaterials, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961211003711 Chromatographic resolution of tryptophan enantiomers with l-Leu-l-Leu-l-Leu peptide: Effects of mobile phase composition and chromatographic support DB Kaufman, T Hayes, J Buettner, DJ Hammond - of Chromatography A, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967399012996 Rescue of the immunotherapeutic potential of a novel T cell epitope in the Epstein-Barr virus latent membrane protein 2 A Lalonde, J Avila-Cari, M Caruso - Virology, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682206007501 Investigation of the adsorption mechanism of a peptide in reversed phase liquid chromatography, from pH controlled and uncontrolled solutions A Andrzejewska, F Gritti, G Guiochon - Journal of Chromatography A, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967309003835

H-AETGQETAYFLLKLA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AETGQETAYFLLKLA-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AETGQETAYFLLKLA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AETGQETAYFLLKLA-OH at the technical inquiry form on this page

Goat anti-human IgG/IgA/IgM (H+L) (FITC) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.

Rabbit polyclonal Synaptophysin antibody

Please enquire for more information about Azapetine including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-VPEPCHPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VPEPCHPK-OH include the following: Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes CH Lee, LN Marekov, SY Kim, JS Brahim, MH Park - FEBS letters, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579300018068

Inhibitor of the sodium-proton exchanger NHE3

Ethomidate is an analog of the anesthetic etomidate that has been found to have anticancer properties. It inhibits the activity of kinases, which are enzymes that regulate cell growth and division. Ethomidate has been shown to induce apoptosis, or programmed cell death, in cancer cells by inhibiting elastase activity. It also inhibits the growth of tumors in mice with human cancer cell xenografts. Ethomidate has potential as a therapeutic agent for the treatment of cancer and may be useful as a kinase inhibitor in other diseases as well. Its effectiveness can be measured through urine analysis and it has shown promising results in preclinical studies.

The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types. This antibody has been extensively tested and validated for its specificity and sensitivity. It shows minimal cross-reactivity with other proteins, ensuring accurate and reliable results. The ASS1 antibody is available in both monoclonal and polyclonal forms, providing options for different experimental needs. In addition to its research applications, the ASS1 antibody has potential therapeutic applications as well. Studies have shown that targeting ASS1 can have anti-tumor effects in certain cancers, making this antibody a promising candidate for cancer therapy. Whether you are conducting research or developing new therapies, the ASS1 antibody is a valuable tool that can help

Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-YGGFLRRI-OH include the following: Lethal factor active-site mutations affect catalytic activity in vitro SE Hammond, PC Hanna - Infection and immunity, 1998 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.66.5.2374-2378.1998 Improved 3D triple resonance experiments, HNN and HN (C) N, for HN and 15N sequential correlations in (13C, 15N) labeled proteins: application to unfolded SC Panchal, NS Bhavesh , RV Hosur - Journal of biomolecular NMR, 2001 - Springerhttps://link.springer.com/article/10.1023/A:1011239023422 In vivo detection of optically-evoked opioid peptide release R Al-Hasani , JMT Wong , OS Mabrouk , JG McCall - Elife, 2018 - elifesciences.orghttps://elifesciences.org/articles/36520 Application of HN (C) N to rapid estimation of 1J (N-Calpha) coupling constants correlated to ψ torsion angles in proteins: implication to structural genomics NS Bhavesh , A Chatterjee, SC Panchal - and biophysical research , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X03020898 Neuroprotective peptides and new strategies for ischemic stroke drug discoveries LV Dergunova, IB Filippenkov, SA Limborska - Genes, 2023 - mdpi.comhttps://www.mdpi.com/2073-4425/14/5/953 Identification of synaptic metabolites of dynorphin A (1-8) by electrospray ionization and tandem mass spectrometry L Prokai , AD Zharikova - Rapid communications in mass , 1998 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0231(19981130)12:22%3C1796::AID-RCM362%3E3.0.CO;2-7 Comparative distribution of neurons containing FLFQPQRFamide-like (morphine-modulating) peptide and related neuropeptides in the rat brain L Kivipelto, P Panula - European Journal of Neuroscience, 1991 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1460-9568.1991.tb00078.x Secondary structure transitions and aggregation induced in dynorphin neuropeptides by the detergent sodium dodecyl sulfate L Hugonin, A Barth, A Graslund - Biochimica et Biophysica , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273608002198 12 Ion Mobility MALDI AS Woods , JA Schultz, SN Jackson - Ion Mobility Spectrometry , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=jodz0-V-lUAC&oi=fnd&pg=PA257&dq=(%22LCBiot-YGGFLRRI-OH%22+OR+%22YGGFLRRI%22)+AND+peptide&ots=3UR3veboqz&sig=9rqwDURLOMBz_dMeZs24_fhv_-s Sulfation, the Up-and-Coming Post-Translational Modification: Its Role and Mechanism in Protein-Protein Interaction AS Woods , HYJ Wang, SN Jackson - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr060529g Dynorphin A (1-8) in human placenta: amino acid sequence determined by tandem mass spectrometry A Agbas , MS Ahmed , W Millington, B Cemerikic - Peptides, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/019697819500013A

Ac-LGAEDGCISTKE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-LGAEDGCISTKE-NH2 is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-LGAEDGCISTKE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-LGAEDGCISTKE-NH2 at the technical inquiry form on this page

NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK

A synthetic peptide for use as a blocking control in assays to test for specificity of NR0B1 antibody, catalog no. 70R-1004

Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a &beta;-ribbon connector region. While E2 is essential for mediating viral attachment, E1&rsquo;s &beta;-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host&rsquo;s membrane. This primarily occurs through the insertion of the DII domain&rsquo;s fusion loop into the host&rsquo;s cell membrane.</p> <p>Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2&rsquo;s A and B domains and E1&rsquo;s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus

Cyclin D1 is a key regulator of cell proliferation and its expression and accumulation within cells is under tight control. Cyclin D1 is the regulatory subunit of cyclin-dependent kinases 4 and 6. These activated cyclin dependent kinases then phosphorylate the retinoblastoma protein (Rb) and drive G1 to S phase progression. Cyclin D1 promotes cell proliferation through interaction with transcription factors such as the oestrogen receptor and specificity protein 1 (Sp1). Cell proliferation is extremely sensitive to altered levels of cyclin D1, with even modest changes in its expression having noticeable effects on cell cycle progression. Cyclin D1 is a proto-oncogene and its overexpression is one of the most frequent alterations seen in multiple cancer types._x000D_ _x000D_ This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.

H-IWGCSGKLICTTNVP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IWGCSGKLICTTNVP-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IWGCSGKLICTTNVP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IWGCSGKLICTTNVP-OH at the technical inquiry form on this page

Rabbit polyclonal HTR1B antibody

Purified recombinant p15, p17, p47 Treponema Pallidum protein

Purified recombinant DCUN1D2 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of FUNDC1 antibody, catalog no. 70R-3364

Purified Polyclonal DOCK11 antibody

Purified Polyclonal Netrin 1 antibody

CD122 antibody (Allophycocyanin) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of NCBP1 antibody, catalog no. 70R-4645

Rabbit anti-human IgG (HRP) was raised in rabbit using human IgG F(c) fragment as the immunogen.

Custom research peptide; min purity 95%.

The VGLL1 antibody is a highly specific monoclonal antibody that targets mesothelin, a serum albumin protein. It is widely used in the field of Life Sciences for various research applications. This antibody has been shown to effectively detect and quantify mesothelin levels in biological samples, making it an invaluable tool for studying its expression and function. Additionally, the VGLL1 antibody has been proven to modulate glutamate signaling and regulate e-cadherin expression, which are essential processes in cellular communication and adhesion. Furthermore, this antibody has demonstrated interactions with other important proteins such as osteopontin, oncostatin, and β-catenin, suggesting its involvement in multiple signaling pathways. The VGLL1 antibody is available as both monoclonal and polyclonal antibodies and is compatible with human serum samples. With its high specificity and ability to activate downstream signaling pathways, the VGLL1 antibody is an indispensable resource for researchers in various fields of study.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

The BAX antibody is a monoclonal antibody that specifically targets protein-protein interactions involving BAX. It is commonly used in research and pharmaceutical applications to study the role of BAX in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity, ensuring reliable results in experiments. The BAX antibody is highly specific to BAX and does not cross-react with other proteins. It binds to BAX with high affinity, allowing for accurate detection and quantification of BAX levels in samples. This antibody can be used for various techniques, including Western blotting, immunohistochemistry, and immunofluorescence. In addition to its use in basic research, the BAX antibody also has potential clinical applications. It can be used as a diagnostic tool to detect abnormal levels of BAX in patient samples, which may indicate certain diseases or conditions. Furthermore, this antibody can be utilized in the development of therapeutic strategies targeting BAX-mediated pathways. The BAX antibody is

Peptide H-YGRKKRRQRRRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YGRKKRRQRRRC-NH2 include the following: Direct Nucleus-Targeted Drug Delivery Using Cascade pHe/Photo Dual-Sensitive Polymeric Nanocarrier for Cancer Therapy Z Cao, D Li , J Wang, M Xiong , X Yang - Small, 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/smll.201902022 Nuclear delivery of nanoparticle-based drug delivery systems by nuclear localization signals Y Nie, G Fu, Y Leng - Cells, 2023 - mdpi.comhttps://www.mdpi.com/2073-4409/12/12/1637 NIR-II Absorbing Semiconducting Polymer-Triggered Gene-Directed Enzyme Prodrug Therapy for Cancer Treatment X Zhang, Y Yang, T Kang, J Wang, G Yang, Y Yang - Small, 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/smll.202100501 Bright and photostable organic fluorescent dots with aggregation-induced emission characteristics for noninvasive long-term cell imaging W Qin, K Li , G Feng , M Li, Z Yang - Advanced Functional , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adfm.201302114 A Cell-Penetrating Peptide Modified Cu2−xSe/Au Nanohybrid with Enhanced Efficacy for Combined Radio-Photothermal Therapy R Ran, S Guo, X Jiang, Z Qian, Z Guo, Y Wang, M Cao - Molecules, 2023 - mdpi.comhttps://www.mdpi.com/1420-3049/28/1/423 Exogenous cell surface modification with cell penetrating peptide-conjugated lipids causes spontaneous cell adhesion M Noiri, Y Goto, Y Sato , N Nakamura - ACS Applied Bio , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsabm.1c00335 Photoswitchable Ultrafast Transactivator of Transcription (TAT) Targeting Effect for Nanocarrier-Based On-Demand Drug Delivery J Wang, S Shen , D Li , C Zhan , Y Yuan - Advanced Functional , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adfm.201704806 TAT peptide-modified cisplatin-loaded iron oxide nanoparticles for reversing cisplatin-resistant nasopharyngeal carcinoma H Weng, NK Bejjanki, J Zhang, X Miao, Y Zhong - Biochemical and , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X19303183 Combined apoptotic effects of peptide and miRNA in a peptide/miRNA nanocomplex H Kim, M Kitamatsu, T Ohtsuki - Journal of bioscience and bioengineering, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1389172318308181 Organelle-targeted photothermal agents for cancer therapy E Hwang, HS Jung - Chemical Communications, 2021 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2021/cc/d1cc02168k

Soluble β-cyclodextrin polymer crosslinked with epichlorohydrin

TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

C14ORF148 antibody was raised using the middle region of C14Orf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG

H-LQYRRLRKGYAPLME-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LQYRRLRKGYAPLME-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LQYRRLRKGYAPLME-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LQYRRLRKGYAPLME-OH at the technical inquiry form on this page

Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT

CD19 antibody (biotin) was raised in mouse using human CD19 as the immunogen.

Purified recombinant Human SEC13 protein

Purified recombinant Human PIN4 protein

Febuxostat-acyl-β-D-glucuronide

Mouse monoclonal CXorf26 antibody

Benzo[g]chrysene

Peptide H-RPIIRPATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RPIIRPATL-OH include the following: CD8+ T-cell responses towards conserved influenza B virus epitopes across anatomical sites and age T Menon , PT Illing , P Chaurasia , HA McQuilten - Nature , 2024 - nature.comhttps://www.nature.com/articles/s41467-024-47576-y A broad cytotoxic T lymphocyte response to influenza type B virus presented by multiple HLA molecules. PA Robbins, PA Rota, SZ Shapiro - International immunology, 1997 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/9/6/815/735070 Influenza B virus-specific CD8+ T-lymphocytes strongly cross-react with viruses of the opposing influenza B lineage CE van de Sandt, YY Dou - Journal of General , 2015 - microbiologyresearch.orghttps://www.microbiologyresearch.org/content/journal/jgv/10.1099/vir.0.000156

A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-1144

Rabbit polyclonal SP1 antibody

T-26c is a peptide that binds to the T-type calcium channel and activates it. T-26c is a high purity, potent activator of T-type calcium channels. It is also a ligand for the receptor, which is involved in regulating many cell functions such as neurotransmitter release, muscle contraction, inflammation, and blood pressure. T-26c can also be used as an antibody or as a research tool for studying the role of these channels in cells.

GnRHR antibody was raised in mouse using highly pure human gonadotropin releasing hormone receptor as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB8B antibody, catalog no. 70R-9843

MW of the antigen is ca 12 kD.

Peptide H-IPVIIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IPVIIER^-OH include the following: miR-103-3p Regulates the Differentiation and Autophagy of Myoblasts by Targeting MAP4 X Zhang, S Huang, X Niu, S Li, J Wang - International Journal of , 2023 - mdpi.comhttps://www.mdpi.com/1422-0067/24/4/4130 Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy JD Mancias, X Wang, SP Gygi , JW Harper - Nature, 2014 - nature.comhttps://www.nature.com/articles/nature13148

Rabbit polyclonal GR antibody (Ser226)

RAB11FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Peptide H-IHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IHP-OH include the following: An Investigation of the Distal Histidyl H-Bonds in Oxyhemoglobin: Effects of Temperature, pH, and Inositol Hexaphosphate Y Yuan, V Simplaceanu, NT Ho, C Ho - Biophysical Journal, 2011 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(10)02916-4.pdf An investigation of the distal histidyl hydrogen bonds in oxyhemoglobin: effects of temperature, pH, and inositol hexaphosphate Y Yuan, V Simplaceanu, NT Ho, C Ho - Biochemistry, 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi100927p NMR investigation of the dynamics of tryptophan side-chains in hemoglobins Y Yuan, V Simplaceanu, JA Lukin, C Ho - Journal of molecular biology, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283602007040 Effect of heating on the digestibility of isolated hempseed (Cannabis sativa L.) protein and bioactivity of its pepsin-pancreatin digests Y Lin , P Pangloli, X Meng, VP Dia - Food chemistry, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0308814620300455 Purification and spectral characterization of the heme undecapeptide TC Chen - 1984 - ideals.illinois.eduhttps://www.ideals.illinois.edu/items/95984/bitstreams/309547/data.pdf A proton nuclear magnetic resonance investigation of proximal histidyl residues in human normal and abnormal hemoglobins. A probe for the heme pocket S Takahashi, AK Lin, C Ho - Biophysical Journal, 1982 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(82)84487-1.pdf An iRGD peptide conjugated heparin nanocarrier for gastric cancer therapy S Ai, S Zhen, Z Liu, F Sun, X He, F Chu, W Guan - RSC , 2018 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2018/ra/c8ra05071f Hydrogen-exchange labeling study of the allosteric R-state to T-state equilibrium in methemoglobin RE McKinnie, JJ Englander , SW Englander - Chemical physics, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0301010491870724 Preparation and purification of carbamylated intermediates of human hemoglobin RC William Jr, LL Chung, TM Schuster - Biochemical and Biophysical , 1975 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X7580413X O-raffinose crosslinked hemoglobin lacks site-specific chemistry in the central cavity: Structural and functional consequences of beta93Cys modification RA Boykins, PW Buehler , Y Jia - Proteins: Structure , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prot.20453 Identification of the sites of deoxyhaemoglobin PEGylation R Iafelice, S Cristoni, D Caccia, R Russo - Biochemical , 2007 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/403/1/189/42038 Synthesis and NMR spectroscopy of peptides containing either phosphorylated or phosphonylated cis- or trans-4-hydroxy-L-proline R HOFFMAN , T HOFFMAN, A Tholey - Journal of peptide , 1997 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb00611.x Enzyme Kinetics Studies of Spin-Labeled Active Human Immunodeficiency Virus Type 1 protease PW D'Amore - Biophysical Journal, 2011 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(10)02915-2.pdf Interaction between inositol hexaphosphate and carbobenzoxy peptide: A model for nucleic acid-nonhistone chromosomal protein interaction PK Nandi - Origins of life, 1978 - Springerhttps://link.springer.com/article/10.1007/BF00931412 Biophysical Characterization of Interactions of Heparin with HIV-1 Tat Peptide 47-57 and ITS Perturbation by Cationic Small Molecule N Tiwari - Biophysical Journal, 2018 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(17)33544-0.pdf Development of fluorescence-conjugated islet-homing peptide using biopanning for targeted optical imaging of pancreatic islet MJ Kim, JH Yu, MH Oh, YS Nam , DY Lee - Journal of Industrial and , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1226086X16303884 Modification of local and global conformational stability of hemoglobin by the allosteric effectors BPG and IHP ME Ali - 2004 - spectrum.library.concordia.cahttps://spectrum.library.concordia.ca/id/eprint/8127/ Effect of reversed heme orientation on circular dichroism and cooperative oxygen binding of human adult hemoglobin M Nagai, Y Nagai, Y Aki, K Imai, Y Wada - Biochemistry, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi7015519 R-state hemoglobin bound to heterotropic effectors: models of the DPG, IHP and RSR13 binding sites M Laberge, I Kövesi, T Yonetani, J Fidy - FEBS letters, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579304015704 Proline isomerization in molecular dynamics simulations of a proline-rich signaling peptide KA Ball , J Alcantara, EJ Stollar - Biophysical Journal, 2022 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(21)02711-9.pdf T-quaternary structure of oxy human adult hemoglobin in the presence of two allosteric effectors, L35 and IHP K Kanaori, Y Tajiri, A Tsuneshige, I Ishigami - et Biophysica Acta (BBA , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005272811001459 Interaction of fully liganded valency hybrid hemoglobin with inositol hexaphosphate. Implication of the IHP-induced T state of human adult methemoglobin in the low I Morishima, M Hara, K Ishimori - Biochemistry, 1986 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/bi00370a071 Linked functions in heme systems: oxidation-reduction potentials and absorption spectra of a heme peptide obtained upon peptic hydrolysis of cytochrome C HA Harbury, PA Loach - Proceedings of the National , 1959 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.45.9.1344 Proton nuclear magnetic resonance investigation of the allosteric transition in ligated and unligated carp hemoglobin: Evidence for structural heterogeneity in the GN La Mar, T Jue, BM Hoffman, K Nagai - Journal of Molecular Biology, 1984 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0022283684903206 Structural and Functional Studies of Hemoglobin Suresnes COFDAN OXYGEN-LINKED - researchgate.nethttps://www.researchgate.net/profile/Celia-Bonaventura/publication/15789536_Structural_and_functional_studies_of_hemoglobin_Suresnes_Arg_141a_2_His_b_2_Consequences_of_disrupting_an_oxygen-linked_anion-binding_site/links/02e7e52fe5b2813408000000/Structural-and-functional-studies-of-hemoglobin-Suresnes-Arg-141a-2-His-b-2-Consequences-of-disrupting-an-oxygen-linked-anion-binding-site.pdf Analysis of uromodulin polymerization provides new insights into the mechanisms regulating ZP domain-mediated protein assembly C Schaeffer, S Santambrogio, S Perucca - Molecular biology of , 2009 - Am Soc Cell Biolhttps://www.molbiolcell.org/doi/abs/10.1091/mbc.E08-08-0876 Isothermal Titration Calorimetry and Oxygen Binding Studies between Inositol Hexakisphosphate and Human Hemoglobin A Tsuneshige, T Yonetani - Biophysical Journal, 2018 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(17)33545-2.pdf Flexibility of the NH,-Terminal Region of the 8 Chains of Hemoglobin: Correlation with the Gelation Properties of Deoxyhemoglobin S A Arnone, PD Briley, PH Rogers - The Molecular Basis of Mutant , 2013 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=CPTJCgAAQBAJ&oi=fnd&pg=PA109&dq=(%22NH2-Ile-His-Pro-OH%22+OR+%22IHP%22+OR+%22H-IHP-OH%22)+AND+peptide&ots=WlLuerCKyI&sig=CIZjWoyLPFKDfF2au8mHbEbtZeI Flexibility of the NH,-Terminal Region of the 8 Chains of Hemoglobin: Correlation with the Gelation Properties of Deoxyhemoglobin S A Arnone, PD Briley, PH Rogers - The Molecular Basis of Mutant , 2013 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=CPTJCgAAQBAJ&oi=fnd&pg=PA109&dq=(%22NH2-Ile-His-Pro-OH%22+OR+%22IHP%22+OR+%22H-IHP-OH%22)+AND+peptide&ots=WlLuerCLsI&sig=IpFcg8X6IAloT-YeiegIdCDTQJs

Peptide H-SRKEYVSMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SRKEYVSMY-OH include the following: UreB immunodominant epitope-specific CD8+ T-cell responses were beneficial in reducing gastric symptoms in Helicobacter pylori-infected individuals T He, F Zhang, J Zhang, S Wei, J Ning, H Yuan- Helicobacter, 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/hel.12959

1-(7Z-Hexadecenoyl)-rac-glycerol is a monoacylglycerol, which is a type of lipid commonly found in various biological systems. This compound is typically derived from natural sources such as plant oils or synthesized for research purposes. Its mode of action involves acting as a signaling molecule within cell membranes, where it can influence various biochemical pathways. This lipid can interact with specific enzymes and receptors, contributing to cellular regulation processes. In scientific research, 1-(7Z-Hexadecenoyl)-rac-glycerol is often utilized to study lipid signaling pathways and metabolic functions. It serves as a standard in analytical studies to understand lipid metabolism and is instrumental in investigating the mechanisms of lipid-related disorders. Additionally, this compound can be used in the development of novel therapeutic approaches targeting metabolic and inflammatory diseases. Scientists value this product for its role in elucidating the biochemical roles of lipids within cellular processes.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

CENPE Monoclonal Antibody

Mouse Monoclonal ATF2 antibody

Please enquire for more information about Phentermine-d5 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant Human DNAJC19 protein

MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Mouse monoclonal Complement D antibody (Biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDC45L antibody, catalog no. 70R-5557

Vimentin antibody (FITC) was raised in mouse using vimentin purified from bovine lens as the immunogen.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Calcium channel blocker

Purified recombinant CTSW protein (His tag)

Rabbit polyclonal AML1 antibody (Ser276)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4826

ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.

SULT1B1 antibody was raised using the N terminal of SULT1B1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW

Rabbit polyclonal RPS16 antibody (HRP)

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPA1 antibody, catalog no. 70R-3549

Mouse monoclonal SIL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF589 antibody, catalog no. 70R-8218

Please enquire for more information about 8-(3-Ethoxy-2-hydroxy-3-methylbutyloxy)psoralen including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CTPS antibody, catalog no. 70R-1217

D-tert-Leucine is used for synthesis of amino acids e.g. in the synthesis of aldehydes by double alkylation of unsaturated aldimines of tert-Leu esters. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Peptide H-VMAPKTLVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VMAPKTLVL-OH include the following: Analysis of HLA-E peptide-binding specificity and contact residues in bound peptide required for recognition by CD94/NKG2 JD Miller, DA Weber, C Ibegbu, J Pohl - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/171/3/1369/973

Peptide H-SFSIIHTPILPLGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFSIIHTPILPLGGC-OH include the following: Chemical modification of chitosan for developing cancer nanotheranostics X Li, Y Wang, C Feng, H Chen, Y Gao - Biomacromolecules, 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biomac.2c00184 Nanoparticles as physically-and biochemically-tuned drug formulations for cancers therapy V Foglizzo, S Marchiaca² - Cancers, 2022 - mdpi.comhttps://www.mdpi.com/2072-6694/14/10/2473 Hybrid nanoparticles for detection and treatment of cancer MJ Sailor , JH Park - Advanced materials, 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adma.201200653 Are smart delivery systems the solution to overcome the lack of selectivity of current metallodrugs in cancer therapy? JF Machado , TS Morais - Dalton Transactions, 2022 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2022/dt/d1dt04079k SP94 peptide mediating highly specific and efficacious delivery of polymersomal doxorubicin hydrochloride to hepatocellular carcinoma in vivo J Zhang, X Wang, L Cheng, J Yuan, Z Zhong - Colloids and Surfaces B , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0927776520307554 The targeted delivery of multicomponent cargos to cancer cells by nanoporous particle-supported lipid bilayers CE Ashley, EC Carnes , GK Phillips, D Padilla - Nature materials, 2011 - nature.comhttps://www.nature.com/articles/nmat2992

Mouse monoclonal CD15 antibody (biotin)

Mouse monoclonal Hantavirus (Hantaan) antibody

Orelabrutinib is a small-molecule Bruton’s tyrosine kinase (BTK) inhibitor, which is synthesized chemically. This selective inhibitor targets BTK, a key enzyme involved in the B-cell receptor signaling pathway. By binding covalently to cysteine-481 in BTK, orelabrutinib effectively blocks the downstream signaling, leading to apoptosis of malignant B-cells. Orelabrutinib is utilized primarily in the treatment of B-cell malignancies, such as chronic lymphocytic leukemia (CLL) and mantle cell lymphoma (MCL). Its high selectivity for BTK minimizes off-target effects, providing a more favorable safety profile compared to earlier generation BTK inhibitors. The compound's pharmacokinetic properties allow for potent and sustained inhibition of BTK, offering an effective therapeutic option for patients with these hematological cancers. Orelabrutinib's role in targeted cancer therapy exemplifies the ongoing advancements in precision medicine, offering hope for improved management of B-cell-derived malignancies.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.

Mouse monoclonal Cathepsin D antibody

Mouse monoclonal PDSS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FTHL17 antibody, catalog no. 70R-6380

Please enquire for more information about Nidogen/Enactin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-EEPQTVPEMPGETPPLSPIDMESQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EEPQTVPEMPGETPPLSPIDMESQER^-OH include the following: Inhibition of c-Jun DNA binding by mitogen-activated protein kinase. SY Chou, V Baichwal, JE Ferrell Jr - Molecular biology of the cell, 1992 - Am Soc Cell Biolhttps://www.molbiolcell.org/doi/abs/10.1091/mbc.3.10.1117 Biochemical and genetic analysis of two map kinase substrates, c-Jun and Rsk S Chou - 1998 - search.proquest.comhttps://search.proquest.com/openview/c21f8ecdd2a6d9308c4ca73bfbd5cff8/1?pq-origsite=gscholar&cbl=18750&diss=y

G907 is an anticancer drug that targets specific proteins involved in cell cycle regulation and tumor growth. It acts as a potent kinase inhibitor, blocking the activity of enzymes that promote cancer cell proliferation. G907 has been shown to be effective against various types of cancers including leukemia and solid tumors. This medicinal compound is derived from Chinese herbal medicine and has shown promising results in inducing apoptosis, or programmed cell death, in cancer cells. G907 is excreted through urine and has minimal side effects compared to traditional chemotherapy drugs. Its unique mechanism of action makes it a promising candidate for future cancer therapies.