Prodotti biochimici e reagenti

Ac-ERQRRNELARSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNELARSFFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNELARSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNELARSFFALRDQI-OH at the technical inquiry form on this page

Peptide H-NLLSVAYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NLLSVAYK-OH include the following: Targeted proteomics strategy applied to biomarker evaluation YJ Kim, S Gallien, J van Oostrum - PROTEOMICS-Clinical , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201300070 Quantitative proteomes and in vivo secretomes of progressive and regressive UV-induced fibrosarcoma tumor cells: Mimicking tumor microenvironment using a Y Shi, CA Elmets, JW Smith, YT Liu, YR Chen - , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200700425 Large-scale analysis of posttranslational modifications in the hippocampus of patients with Alzheimer's disease using pI shift and label-free quantification without T Kang , JH Kim, I Hong , N Park, H Heinsen - Analytical and , 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-7933-2 CSF 14-3-3beta is associated with progressive cognitive decline in Alzheimer's disease Q Qiang, L Skudder-Hill, T Toyota, Z Huang - Brain , 2023 - academic.oup.comhttps://academic.oup.com/braincomms/article-abstract/5/6/fcad312/7441647 A novel thrombin inhibitory peptide discovered from leech using affinity chromatography combined with ultra-high performance liquid chromatography-high resolution Q Huang, Q Gao, X Chai, W Ren, G Zhang - of Chromatography B, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023220303354 The inhibitor protein of phosphorylated nitrate reductase from spinach (Spinacia oleracea) leaves is a 14-3-3 protein M Bachmann, JL Huber, PC Liao, DA Gage - FEBS , 1996 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/0014-5793(96)00478-4 Software tool for visualization and validation of protein turnover rates using heavy water metabolic labeling and LC-MS HM Deberneh, RG Sadygov - International journal of molecular sciences, 2022 - mdpi.comhttps://www.mdpi.com/1422-0067/23/23/14620 Potential prognostic value of CSF-targeted proteomics across the Alzheimer's disease continuum B Xu, Y Ling, L Liu, Y Liu, Y Lin, J Lyu , Y Zhang - BMC geriatrics, 2024 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC11157758/

Mouse monoclonal C20orf43 antibody

HSD17B14 antibody was raised in Rabbit using Human HSD17B14 as the immunogen

High sensitivity HRP microwell liquid substrate (containing TMB)

MDIAIHHPWI RRPFFPFHSP SRLFDQFFGE HLLESDLFPT STSLSPFYLR PPSFLRAPSW FDTGLSEMRL EKDRFSVNLD VKHFSPEELK VKVLGDVIEV HGKHEERQDE HGFISREFHR KYRIPADVDP LTITSSLSSD GVLTVNGPRK QVSGPERTIP ITREEKPAVT AAPKK

Mouse monoclonal CYP2B1 + CYP2B2 antibody

4,4?-Bis(mercaptomethyl)biphenyl

Aluminum stearate is used for waterproofing fabrics and for thickening lubricating oils. It is involved in the preparation of polyamides and thermosetting plastics. It is used as a waterproofing additive in cements and in light-sensitive photographic compositions. It acts as a gelling agent for alkyd paints, as a defoamer for oil drilling fluids and as a retarder for polysulfide dental impression materials. Further, it is used in greases, lubricants, cutting compounds, cosmetics and pharmaceuticals. It serves as a flatting agent, as a defoaming agent in beet sugar and yeast processing. In addition to this, it is used as a water-repellent soap for natural stone surfaces. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

RFP Tag antibody was raised in mouse using RFP from the Discosoma sea anemone N-terminal peptide-KLH conjugates as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ercc1 antibody, catalog no. 70R-9364

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F5 antibody, catalog no. 70R-1798

A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT13 antibody, catalog no. 70R-7449

1-270 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMLS AHWEKKKTSL VELQEQLQQL PALIADLESM TANLTHLEAS FEEVENNLLH LEDLCGQCEL ERCKHMQSQQ LENYKKNKRK ELETFKAELD AEHAQKVLEM EHTQQMKLKE RQKFFEEAFQ QDMEQYLSTG YLQIAERREP IGSMSSMEVN VDMLEQMDLM DISDQEALDV FLNSGGEENT VLSPALGPES STCQNEITLQ VPNPSELRAK PPSSSSTCTD SATRDISEGG ESPVVQSDEE EVQVDTALAT SHTDREATPD GGEDSDS

RU 24213 is an irreversible inhibitor of the dopamine transporter and competitively inhibits binding at the dopamine receptor. It has shown to have interactive effects on locomotor activity with quinpirole, a D2-receptor agonist, as well as with glutamate, a neurotransmitter that plays an important role in brain function. RU 24213 has also been shown to have antagonistic effects at kappa-opioid receptors in rats striata.

A synthetic peptide for use as a blocking control in assays to test for specificity of CLN8 antibody, catalog no. 70R-7114

Rabbit polyclonal IRS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF382 antibody, catalog no. 20R-1228

Magnesium L-aspartate

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Please enquire for more information about CBDA 510 bS including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4644

Influenza B antibody was raised in mouse using nucleoprotein of influenza virus type B as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC7 antibody, catalog no. 70R-10103

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0A1 antibody, catalog no. 70R-6858

Peptide H-LLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLL^-OH include the following: Synthesis of tripeptide amide derivatives and examination of their inhibitory effect on human leukocyte elastase (HLE) Y TSUDA, N TENo, Y OKADA - Chemical and , 1988 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/cpb1958/36/8/36_8_3119/_article/-char/ja/ Crystallographic studies on the binding of selectively deuterated LLD-and LLL-substrate epimers by isopenicillin N synthase W Ge, IJ Clifton, JE Stok, RM Adlington - Biochemical and , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X10012866 The ability of lower peptides to form co-crystals: inclusion compounds of Leu-Leu-Leu tripeptide with pyridine and picolines TJ Burchell, DV Soldatov , GD Enright - CrystEngComm, 2007 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2007/ce/b708695d Gene expression and peptide localization for LH-hCG receptor in porcine small and large luteal cells: possible regulation by opioid peptides T Kaminski , B Gawronska, K Derecka - Journal of Physiology , 2000 - agro.icm.edu.plhttps://agro.icm.edu.pl/agro/element/bwmeta1.element.agro-article-a5150f5d-45f4-4baa-b997-f700dc380ed3 Role of tripeptidyl peptidase II in the processing of Listeria monocytogenes-derived MHC class I-presented antigenic peptides S Grauling-Halama, U Bahr, S Schenk, G Geginat - Microbes and infection, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457909000987 Local effect of glycine substitution in a model helical peptide PC Lyu , PC Wang , MI Liff - Journal of the American , 1991 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/ja00009a052 Interaction of l-leucyl-l-leucyl-l-leucine thin film with water and organic vapors: receptor properties and related morphology MA Ziganshin , IG Efimova - Journal of Peptide , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1431 Thermal analysis of clathrates of tripeptide LLL with organic compounds and water MA Ziganshin , AV Gerasimov , VV Gorbatchuk - Journal of Thermal , 2015 - Springerhttps://link.springer.com/article/10.1007/s10973-014-4279-0 A combination of tri-leucine and angiopep-2 drives a polyanionic polymalic acid nanodrug platform across the blood-brain barrier LL Israel , O Braubach , A Galstyan, A Chiechi - ACS , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsnano.8b06437 Separation of D-amino acid-containing peptide phenylseptin using 3, 3'-phenyl-1, 1'-binaphthyl-18-crown-6-ether columns I Kawamura , B Mijiddorj , Y Kayano, Y Matsuo - et Biophysica Acta (BBA , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570963920300765 In vitro and in vivo activity of antimicrobial peptides synthesized based on the insect defensin H Saido-Sakanaka, J Ishibashi, E Momotani, F Amano - Peptides, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978103004236 Inhibition of rat liver cathepsins B and L by the peptide aldehyde benzyloxycarbonyl-leucyl-leucyl-leucinal and its analogues H Ito, M Watanabe, YT Kim - Journal of enzyme , 2009 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/14756360802166921 The optimization of polymalic acid peptide copolymers for endosomolytic drug delivery H Ding, J Portilla-Arias, R Patil , KL Black , JY Ljubimova - Biomaterials, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961211003711 Chromatographic resolution of tryptophan enantiomers with l-Leu-l-Leu-l-Leu peptide: Effects of mobile phase composition and chromatographic support DB Kaufman, T Hayes, J Buettner, DJ Hammond - of Chromatography A, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967399012996 Rescue of the immunotherapeutic potential of a novel T cell epitope in the Epstein-Barr virus latent membrane protein 2 A Lalonde, J Avila-Cari, M Caruso - Virology, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682206007501 Investigation of the adsorption mechanism of a peptide in reversed phase liquid chromatography, from pH controlled and uncontrolled solutions A Andrzejewska, F Gritti, G Guiochon - Journal of Chromatography A, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967309003835

H-AETGQETAYFLLKLA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AETGQETAYFLLKLA-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AETGQETAYFLLKLA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AETGQETAYFLLKLA-OH at the technical inquiry form on this page

Goat anti-human IgG/IgA/IgM (H+L) (FITC) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.

Rabbit polyclonal Synaptophysin antibody

Please enquire for more information about Azapetine including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-VPEPCHPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VPEPCHPK-OH include the following: Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes CH Lee, LN Marekov, SY Kim, JS Brahim, MH Park - FEBS letters, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579300018068

Inhibitor of the sodium-proton exchanger NHE3

Ethomidate is an analog of the anesthetic etomidate that has been found to have anticancer properties. It inhibits the activity of kinases, which are enzymes that regulate cell growth and division. Ethomidate has been shown to induce apoptosis, or programmed cell death, in cancer cells by inhibiting elastase activity. It also inhibits the growth of tumors in mice with human cancer cell xenografts. Ethomidate has potential as a therapeutic agent for the treatment of cancer and may be useful as a kinase inhibitor in other diseases as well. Its effectiveness can be measured through urine analysis and it has shown promising results in preclinical studies.

The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types. This antibody has been extensively tested and validated for its specificity and sensitivity. It shows minimal cross-reactivity with other proteins, ensuring accurate and reliable results. The ASS1 antibody is available in both monoclonal and polyclonal forms, providing options for different experimental needs. In addition to its research applications, the ASS1 antibody has potential therapeutic applications as well. Studies have shown that targeting ASS1 can have anti-tumor effects in certain cancers, making this antibody a promising candidate for cancer therapy. Whether you are conducting research or developing new therapies, the ASS1 antibody is a valuable tool that can help

Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-YGGFLRRI-OH include the following: Lethal factor active-site mutations affect catalytic activity in vitro SE Hammond, PC Hanna - Infection and immunity, 1998 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.66.5.2374-2378.1998 Improved 3D triple resonance experiments, HNN and HN (C) N, for HN and 15N sequential correlations in (13C, 15N) labeled proteins: application to unfolded SC Panchal, NS Bhavesh , RV Hosur - Journal of biomolecular NMR, 2001 - Springerhttps://link.springer.com/article/10.1023/A:1011239023422 In vivo detection of optically-evoked opioid peptide release R Al-Hasani , JMT Wong , OS Mabrouk , JG McCall - Elife, 2018 - elifesciences.orghttps://elifesciences.org/articles/36520 Application of HN (C) N to rapid estimation of 1J (N-Calpha) coupling constants correlated to ψ torsion angles in proteins: implication to structural genomics NS Bhavesh , A Chatterjee, SC Panchal - and biophysical research , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X03020898 Neuroprotective peptides and new strategies for ischemic stroke drug discoveries LV Dergunova, IB Filippenkov, SA Limborska - Genes, 2023 - mdpi.comhttps://www.mdpi.com/2073-4425/14/5/953 Identification of synaptic metabolites of dynorphin A (1-8) by electrospray ionization and tandem mass spectrometry L Prokai , AD Zharikova - Rapid communications in mass , 1998 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0231(19981130)12:22%3C1796::AID-RCM362%3E3.0.CO;2-7 Comparative distribution of neurons containing FLFQPQRFamide-like (morphine-modulating) peptide and related neuropeptides in the rat brain L Kivipelto, P Panula - European Journal of Neuroscience, 1991 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1460-9568.1991.tb00078.x Secondary structure transitions and aggregation induced in dynorphin neuropeptides by the detergent sodium dodecyl sulfate L Hugonin, A Barth, A Graslund - Biochimica et Biophysica , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273608002198 12 Ion Mobility MALDI AS Woods , JA Schultz, SN Jackson - Ion Mobility Spectrometry , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=jodz0-V-lUAC&oi=fnd&pg=PA257&dq=(%22LCBiot-YGGFLRRI-OH%22+OR+%22YGGFLRRI%22)+AND+peptide&ots=3UR3veboqz&sig=9rqwDURLOMBz_dMeZs24_fhv_-s Sulfation, the Up-and-Coming Post-Translational Modification: Its Role and Mechanism in Protein-Protein Interaction AS Woods , HYJ Wang, SN Jackson - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr060529g Dynorphin A (1-8) in human placenta: amino acid sequence determined by tandem mass spectrometry A Agbas , MS Ahmed , W Millington, B Cemerikic - Peptides, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/019697819500013A

Ac-LGAEDGCISTKE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-LGAEDGCISTKE-NH2 is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-LGAEDGCISTKE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-LGAEDGCISTKE-NH2 at the technical inquiry form on this page

NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK

A synthetic peptide for use as a blocking control in assays to test for specificity of NR0B1 antibody, catalog no. 70R-1004

Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page