Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules
- By Biological Target
- By Pharmacological Effects
- Cryopreservatives
- Desinfectants and Related Compounds
- Hormones
- Plant Biology
- Secondary Metabolites
Products of "Biochemicals and Reagents"
Sort by
D-Threonine
CAS:Formula:C4H9NO3Purity:(Titration) ≥ 98.0%Color and Shape:White to off-white powder or crystalsMolecular weight:119.12CD49d antibody (Azide Free)
CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.…H-NALARYYYDSLG-NH2
H-NALARYYYDSLG-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NALARYYYDSLG-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NALARYYYDSLG-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NALARYYYDSLG-NH2 at the technical inquiry form on this pagePurity:Min. 95%SERPINB5 antibody
SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM1-Triazene, 1-(4-methylphenyl)-3-(phenylmethyl)-
CAS:Formula:C14H15N3Purity:98%Color and Shape:SolidMolecular weight:225.289FCER1G antibody
FCER1G antibody was raised in rabbit using the N terminal of FCER1G as the immunogenPurity:Min. 95%Aflatoxicol
CAS:AflatoxicolFormula:C17H14O6Purity:By hplc: 99.6% (Typical Value in Batch COA)Color and Shape: white powderMolecular weight:314.29g/molPhenol Tris Equilibrated for molecular biology w/o Stabilizer
CAS:Color and Shape:Clear, Colourless, LiquidH-APNVVVTR-OH
Peptide H-APNVVVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-APNVVVTR-OH include the following: p85-RhoGDI2, a novel complex, is required for PSGL-1-induced beta1 integrin-mediated lymphocyte adhesion to VCAM-1 J Luo, T Xu, C Li, X Ba, X Wang, Y Jiang - The International Journal , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S135727251300294X scplainer: using linear models to understand mass spectrometry-based single-cell proteomics data C Vanderaa , L Gatto - bioRxiv, 2023 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2023.12.14.571792.abstractPhenytoin antibody
Phenytoin antibody was raised in mouse using phenytoin conjugated to KLH as the immunogen.Chicken anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%SPDYA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPDYA antibody, catalog no. 70R-27474-Amino-6,7-dimethoxy-1,2-dihydroquinazolin-2-one
CAS:Please enquire for more information about 4-Amino-6,7-dimethoxy-1,2-dihydroquinazolin-2-one including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H11N3O3Purity:Min. 95%Molecular weight:221.21 g/molBMF
Bcl-2-modifying factor (Bmf) belongs to the BH3-only class of Bcl-2 family proteins (along with Bim). Bmf has pro-apoptotic activity and can trigger mitochondrial apoptosis via inhibition of CAP-dependent protein synthesis, it is also involved in B cell development and anoikis. Bmf activity is regulated by dynein light chain (DYNLL) 1 and 2, via inducing its homo-dimerization and leading to the formation of ternary complexes (such as Bim-DYNLL-Bmf).Molecular weight:2,441.3 g/mol
