Biochemicals and Reagents

Serotonin (5-HT) receptor agonist

CXCR4 antibody was raised in rabbit using E. coli-expressed amino acids 2-38 of rat CXCR4 as the immunogen.

Purified Rabbit polyclonal OR5M1 antibody

Armenian Hamster monoclonal CD103 antibody (FITC)

SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Rabbit polyclonal MSK1 antibody (Ser360)

Mouse monoclonal ALOX15 antibody

TAT-Beclin Scrambled is a scrambled version of the peptide derived from a region of the Beclin 1 protein. The original peptide interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.The scrambled sequence in this peptide means it can be used as an effective negative control in such experiments because whilst it contains the same amino acids as Beclin-1 (and thus has the same molecular weight), it does not express the same properties as the original peptide.TAT (47-57) is present due to its properties as a cell penetrating cationic peptide (CPP). It derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). As a CPP, TAT (47-57) is able facilitate the delivery of the Beclin Scrambled protein across the plasma membrane.This peptide contains a GG linker between the C-terminus of TAT (47-57) and the N-terminus of Beclin Scrambled.

18:1 Topfluor Pe is a peptide that belongs to the group of activators. It is an inhibitor for ion channels and has been shown to inhibit protein interactions, receptor binding, and ligand binding. 18:1 Topfluor Pe can be used as a research tool in cell biology, pharmacology, or as a reagent in antibody production. This peptide has been shown to have high purity and is a CAS number 2260795-70-6.

KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN

The CYFRA21-1 antibody is a Monoclonal Antibody that specifically targets the activated form of the CYFRA21-1 protein. This protein is found in human serum and has been associated with various diseases, including cancer. The antibody works by binding to the CYFRA21-1 protein, preventing its interaction with other molecules and inhibiting its function. In addition to its diagnostic applications, the CYFRA21-1 antibody has also shown potential therapeutic benefits. It has been found to have anti-angiogenesis properties, which means it can inhibit the growth of new blood vessels that supply nutrients to tumors. This makes it a promising candidate for cancer treatment. The CYFRA21-1 antibody can be used in various research settings, such as Life Sciences laboratories, to study the role of CYFRA21-1 in disease progression and develop new diagnostic and therapeutic strategies. Its immobilization on an electrode or collagen matrix allows for easy detection and analysis of the protein

Mouse monoclonal IL6 antibody (HRP)

Catalogue peptide; min. 95% purity

MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI

Norovirus genogroup I Antigen

This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

The Codeine antibody is a highly effective antiviral agent that has been specifically designed to target and neutralize the growth factor of codeine in human serum. This antibody is available in both polyclonal and monoclonal forms, ensuring maximum efficacy and specificity. It is widely used in the field of Life Sciences for research purposes, as well as in clinical settings for diagnostic and therapeutic applications. One of the key features of the Codeine antibody is its ability to effectively block the activation of codeine and inhibit its binding to specific receptors. This prevents codeine from exerting its biological effects, making it an invaluable tool for studying codeine-related pathways and processes. In addition to its antiviral properties, this antibody has also shown promising results in inhibiting other targets such as CD33, mesothelin, chemokines, nuclear factors, and alpha-fetoprotein. Its versatility makes it a valuable asset in various research fields, including immunology, oncology, infectious diseases, and

Inhibitor of Aurora A kinase

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool