Biochemicals and Reagents

Protein A antibody (rhodamine) was raised in goat using Protein A [Staphylococcus aureus] as the immunogen.

α-Biotin-ω-carboxysuccinimidyl ester poly(ethyleneglycol), PEG molecular weight 3,000 dalton

S 12 is a polymerase chain that has been shown to be effective in patients with diabetes and women. It has transport properties and can be used for the treatment of fatty acid deficiency. S 12 has been shown to have a chemical stability in femoral vein, which could be due to its thermal expansion. S 12 has low light inhibitory properties and is titrated calorimetry-stable at doses of 10 μM. Logistic regression was used to determine the dose groups for the drug, where the bacterial strain was used as an independent variable.

Peptide H-TMDSNTLEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TMDSNTLEL-OH include the following: Human antigen-specific memory natural killer cell responses develop against HIV-1 and influenza virus and are dependent on MHC-E restriction S Jost , O Lucar , T Yoder , K Kroll , S Sugawara, S Smith - BioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.11.09.374348.abstract Antigen-specific memory NK cell responses against HIV and influenza use the NKG2/HLA-E axis S Jost , O Lucar , E Lee, T Yoder , K Kroll - Science , 2023 - science.orghttps://www.science.org/doi/abs/10.1126/sciimmunol.adi3974

ELISA kit for the detection of ENA in the research laboratory

Rabbit polyclonal AS250 antibody

Nucleolar Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Nucleolar Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

A synthetic peptide for use as a blocking control in assays to test for specificity of CYB5R3 antibody, catalog no. 70R-10194

Peptide H-NILTSNNIDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NILTSNNIDVK^-OH include the following: Urinary protein profiling by liquid chromatography/tandem mass spectrometry: ADAM28 is overexpressed in bladder transitional cell carcinoma YC Tyan, MH Yang, SCJ Chen, SB Jong - in mass spectrometry, 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.5169 Determination of proteins in infant formula by high-performance liquid chromatography-electrospray tandem mass spectrometry SS Hong , JH Park, SW Kwon - Journal of Chromatography B, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023206006325 Quantitation of 87 proteins by nLC-MRM/MS in human plasma: workflow for large-scale analysis of biobank samples M Rezeli , K Sjödin, H Lindberg - Journal of proteome , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00235 Discovery and initial verification of differentially abundant proteins between multiple sclerosis patients and controls using iTRAQ and SID-SRM AC Kroksveen, E Aasebo, H Vethe , V Van Pesch - Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391912006938

NEDD4 antibody was raised in Rabbit using Human NEDD4 as the immunogen

Cathepsin inhibitor

Purified recombinant FBXO6 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLFN12 antibody, catalog no. 70R-4361

Rabbit polyclonal RPL12 antibody

Purified Polyclonal MEOX2 antibody

RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Iacs-9571 hydrochloride is a peptide that can be used to study the interactions of proteins and receptors. It has been shown to activate the potassium channels in neuronal cells and the calcium channels in muscle cells, leading to increased activity. Iacs-9571 hydrochloride also binds with high affinity to ligand-gated ion channels, such as nicotinic acetylcholine receptor (nAChR). This peptide can serve as an antibody for use in cell biology research or as a research tool for studying protein interactions.