Biochemicals and Reagents

Peptide H-YVRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YVRPLWVRME-OH include the following: Pathogenic T cells have a paradoxical protective effect in murine autoimmune diabetes by boosting Tregs Y Grinberg-Bleyer, D Saadoun - The Journal of , 2010 - Am Soc Clin Investighttps://www.jci.org/articles/view/42945 Formulation of hydrophobic peptides for skin delivery via coated microneedles X Zhao, SA Coulman, SJ Hanna, FS Wong - Journal of Controlled , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365916311907 Asparaginyl ligase-catalyzed one-step cell surface modification of red blood cells TJ Harmand , N Pishesha , FBH Rehm, W Ma - ACS Chemical , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.1c00216 Engineering antigens for in situ erythrocyte binding induces T-cell deletion S Kontos, IC Kourtis , KY Dane - Proceedings of the , 2013 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1216353110 Fungal beta-glucan, a Dectin-1 ligand, promotes protection from type 1 diabetes by inducing regulatory innate immune response S Karumuthil-Melethil, R Gudi, BM Johnson - The Journal of , 2014 - journals.aai.orghttps://journals.aai.org/jimmunol/article/193/7/3308/98349 Activation of T cell checkpoint pathways during beta-cell antigen presentation by engineered dendritic cells promotes protection from type 1 diabetes RR Gudi, N Perez , S Karumuthil-Melethil, G Li - , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imm.13476 Complex dietary polysaccharide modulates gut immune function and microbiota, and promotes protection from autoimmune diabetes R Gudi, N Perez , BM Johnson, MH Sofi , R Brown - , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imm.13048 Prevention of type 1 diabetes with acetalated dextran microparticles containing rapamycin and pancreatic peptide P31 N Chen, CJ Kroger, RM Tisch - Advanced , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adhm.201800341 Polysaccharide A-Dependent Opposing Effects of Mucosal and Systemic Exposures to Human Gut Commensal Bacteroides fragilis in Type 1 Diabetes MH Sofi , BM Johnson, RR Gudi, A Jolly - Diabetes, 2019 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/68/10/1975/35369 Cutting edge: type 1 diabetes occurs despite robust anergy among endogenous insulin-specific CD4 T cells in NOD mice KE Pauken , JL Linehan , JA Spanier - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/191/10/4913/86896 Insights into the percutaneous penetration of antidiabetic agents K Ita - Journal of Drug Targeting, 2017 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/1061186X.2016.1221956 Peptide-MHC class II dimers as therapeutics to modulate antigen-specific T cell responses in autoimmune diabetes EL Masteller, MR Warner, W Ferlin - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/171/10/5587/1785 Engineered RBCs encapsulating antigen induce multi-modal antigen-specific tolerance and protect against type 1 diabetes CJ Raposo , JD Cserny, G Serena, JN Chow - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2022.869669/full CD11c+ Cells Are Gatekeepers for Lymphocyte Trafficking to Infiltrated Islets During Type 1 Diabetes AM Sandor, RS Lindsay, N Dyjack - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2019.00099/full

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

CHK1 antibody was raised in Mouse using a purified recombinant fragment of CHK1 expressed in E. coli as the immunogen.

Potent and selective inhibitor of histone deacetylase 6 (HDAC6) with IC50 of 2.4 nM. Its anti-inflammatory activity was examined in a mouse model for acute colitis. The compound protected from intestinal inflammation by prevention of infiltration of CD19+ B-cells into the lamina propria of colonic epithelium and attenuated neutrophil activation. Its broad anti-inflammatory response involved decrease in 24 inflammatory chemokines and cytokines. Also, it is a potent inhibitor of cell proliferation in pancreatic cancer cell lines.

Rabbit polyclonal ZNF774 antibody

Recombinant Human p53

Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SL^EDLQL^THNK^-OH include the following: Multiplex targeted proteomic assay for biomarker detection in plasma: a pancreatic cancer biomarker case study S Pan, R Chen, RE Brand, S Hawley - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr201117w

Phenyl 2-azido-2,6-dideoxy-1-seleno-?-D-galactopyranoside

Cyt-1010 hydrochloride is a peptide that has been shown to modulate ion channels and receptor activity in vitro. Cyt-1010 hydrochloride has been used as a research tool to study the activation of ion channels, the binding of ligands to receptors, and protein interactions. Cyt-1010 hydrochloride is also an inhibitor of certain proteins, such as GTPase and DNA polymerase.

Affinity purified Rabbit polyclonal ZNF169 antibody

ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN

Rabbit anti-goat IgG (H+L) (Rhodamine) was raised in rabbit using goat IgG whole molecule as the immunogen.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

ASP4132 is a small molecule that has been shown to induce cell death in tumor cells through autophagy. It is orally active and can be used as a chemotherapeutic agent. ASP4132 activates the AMP-activated protein kinase, which inhibits the mTORC1 complex, leading to an increase in autophagy and apoptosis. The oral bioavailability of this drug is high and it has been shown to have limited toxicity. Clinical development for this drug is ongoing with toxicities such as anorexia, weight loss, dehydration, and elevated liver enzymes observed.

Peptide H-VGYMHWYQQKPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGYMHWYQQKPGK-OH include the following: Reducing metal-ion mediated adsorption of acidic peptides in RPLC-based assays using hybrid silica chromatographic surfaces RE Birdsall, J Kellett, S Ippoliti, N Ranbaduge - of Chromatography B, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002322100180X

Peptide H-IMIGVLVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IMIGVLVGV-OH include the following: Assessment of cancer and virus antigens for cross-reactivity in human tissues V Jaravine, S Raffegerst, DJ Schendel - , 2017 - academic.oup.comhttps://academic.oup.com/bioinformatics/article-abstract/33/1/104/2525678 Targeting cancers through TCR-peptide/MHC interactions Q He, X Jiang, X Zhou, J Weng - Journal of hematology & oncology, 2019 - Springerhttps://link.springer.com/article/10.1186/s13045-019-0812-8 T-Cell Receptor-Transduced T Cells: Clinical Experience PF Robbins - The Cancer Journal, 2015 - journals.lww.comhttps://journals.lww.com/journalppo/FullText/2015/11000/T_Cell_Receptor_Transduced_T_Cells__Clinical.7.aspx On-and off target toxicity profiling for adoptive cell therapy by mass spectrometry-based immunopeptidome analysis of primary human normal tissues O Schoor, J Fritsche, S Kutscher, A Mahr - Cancer Research, 2016 - AACRhttps://aacrjournals.org/cancerres/article-abstract/76/14_Supplement/2291/609438 Characterization of genetically modified T-cell receptors that recognize the CEA: 691-699 peptide in the context of HLA-A2. 1 on human colorectal cancer cells MR Parkhurst, J Joo, JP Riley, Z Yu, Y Li - Clinical Cancer , 2009 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/15/1/169/73405 Carcinoembryonic antigen (CEA)-based cancer vaccines: recent patents and antitumor effects from experimental models to clinical trials M Turriziani, M Fantini , M Benvenuto - Recent patents on , 2012 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/pra/2012/00000007/00000003/art00004 Signaling via a CD28/CD40 chimeric costimulatory antigen receptor (CoStAR™), targeting folate receptor alpha, enhances T cell activity and augments tumor M Kalaitsidou, OR Moon, M Sykorova, L Bao - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1256491/full Carcinoembryonic antigen transgenic mouse models for immunotherapy and development of cancer vaccines M Bhattacharya-Chatterjee, A Saha - Current Protocols in , 2008 - Wiley Online Libraryhttps://currentprotocols.onlinelibrary.wiley.com/doi/abs/10.1002/0471142735.im2008s80 TAP-independent presentation of CTL epitopes by Trojan antigens J Lu, PJ Wettstein, Y Higashimoto - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/12/7063/33891 A novel transgenic mouse model for immunological evaluation of carcinoembryonic antigen-based DNA minigene vaccines H Zhou, Y Luo, M Mizutani, N Mizutani - The Journal of , 2004 - Am Soc Clin Investighttps://www.jci.org/articles/view/21107 Enhancing immunogenicity of a CTL epitope from carcinoembryonic antigen by selective amino acid replacements E Huarte , P Sarobe, J Lu, N Casares, JJ Lasarte - Clinical cancer , 2002 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/8/7/2336/289158 Identification and validation of viral antigens sharing sequence and structural homology with tumor-associated antigens (TAAs). C Ragone, C Manolio, B Cavalluzzo - for ImmunoTherapy of , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8166618/

Mouse Anti hCG β core

MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen

Recombinant Hirudin