Biochemicals and Reagents

Vimentin antibody was raised in sheep using purified recombinant human vimentin produced in bacteria as the immunogen.

H-LLLAGLFSL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLLAGLFSL-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLLAGLFSL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLLAGLFSL-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1L antibody, catalog no. 70R-2694

The CD115 antibody is a monoclonal antibody that specifically binds to the CD115 receptor, also known as colony-stimulating factor 1 receptor (CSF1R). This receptor is involved in various cellular processes, including cell proliferation, differentiation, and survival. By binding to CD115, the antibody blocks the interaction between CSF1R and its ligand, thereby inhibiting downstream signaling pathways. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas. It has been used to study the role of CSF1R in immune responses, tumor development, and autoimmune diseases. Additionally, CD115 antibodies have been used as diagnostic tools for detecting the presence of autoantibodies against CSF1R in certain conditions. Furthermore, this antibody can be utilized for therapeutic purposes. It can be conjugated with drugs or toxins to create antibody-drug conjugates or antibody-drug inhibitors. These conjugates specifically target cells expressing CD115 and

This Purified Mouse anti-KLH Antibody reacts with Keyhole Limpet Hemocyanin in various immunoassays.

Peptide H-PFPQPEQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PFPQPEQPF-OH include the following: Template-based peptide modeling for celiac risk assessment of newly expressed proteins in GM crops P Song, Z Hou, S Sukumar, RA Herman - Regulatory Toxicology and , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0273230020301410 Characterisation of clinical and immune reactivity to barley and rye ingestion in children with coeliac disease MY Hardy, AK Russell, C Pizzey, CM Jones - Gut, 2020 - gut.bmj.comhttps://gut.bmj.com/content/69/5/830.abstract Consistency in polyclonal T-cell responses to gluten between children and adults with celiac disease MY Hardy, A Girardin, C Pizzey, DJ Cameron - Gastroenterology, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0016508515010070 Reducing the incidence of allergy and intolerance to cereals LJWJ Gilissen, IM van der Meer - Journal of Cereal Science, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0733521014000174 Structural basis of T cell receptor specificity and cross-reactivity of two HLA-DQ2. 5-restricted gluten epitopes in celiac disease L Ciacchi, C Farenc , S Dahal-Koirala , J Petersen - Journal of Biological , 2022 - ASBMBhttps://www.jbc.org/article/S0021-9258(22)00059-X/abstract Comprehensive, quantitative mapping of T cell epitopes in gluten in celiac disease JA Tye-Din, JA Stewart, JA Dromey - Science translational , 2010 - science.orghttps://www.science.org/doi/abs/10.1126/scitranslmed.3001012

ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogen

DNM1L antibody was raised in rabbit using the N terminal of DNM1L as the immunogen

Peptide H-LISEEDLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LISEEDLLR-OH include the following: Examining targeted protein degradation from physiological and analytical perspectives: enabling translation between cells and subjects NA Daurio, H Zhou, Y Chen, PR Sheth - ACS Chemical , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.0c00380

A synthetic peptide for use as a blocking control in assays to test for specificity of RPLP0 antibody, catalog no. 70R-1442

Ac-CLTWSRASGKPVNHSTRK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLTWSRASGKPVNHSTRK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLTWSRASGKPVNHSTRK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLTWSRASGKPVNHSTRK-NH2 at the technical inquiry form on this page

Affinity purified Rabbit polyclonal NDUFV2 antibody

A 27 amino acid peptide toxin from the venom of the Chinese red-headed centipede and a potent activator of TRPV1 capsaicin receptor, inducing intense pain. This product is available in the salt form: trifluoroacetate and has the following disulfide Bonds: Cys1-Cys3, Cys2-Cys4.

06:0-12:0 NBD pg is an artificial fluorescent probe for studying protein interactions and receptor pharmacology. It selectively binds to the extracellular loops of a ligand-gated ion channel, such as nicotinic acetylcholine receptors (nAChRs) and glycine receptors. The fluorescence of 06:0-12:0 NBD pg is quenched by the binding of its ligands to the receptor, indicating that this probe can be used to monitor the conformational changes in these receptors. 06:0-12:0 NBD pg has been used to study nAChRs and glycine receptors in cultured cells and intact animals. In these studies, 06:0-12:0 NBD pg was used as a tool for examining ligand binding kinetics, affinity, and selectivity. This probe is also useful for studying protein interactions with peptides or antibodies. When 06:0-12:0

Haptoglobin antibody was raised in rabbit using highly purified bovine haptoglobin as the immunogen.

Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-EDIIRNIARHLAQVGDSMDR-OH include the following: Design, Synthesis, and Interaction Study of Quinazoline-2(1H)-thione Derivatives as Novel Potential Bcl-xL Inhibitors Y Feng , X Ding, T Chen, L Chen, F Liu - Journal of medicinal , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm901004c A conserved hydrophobic core at Bcl-xL mediates its structural stability and binding affinity with BH3-domain peptide of pro-apoptotic protein Y Feng , L Zhang , T Hu, X Shen, J Ding, K Chen - Archives of biochemistry , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003986109000022 Isochamaejasmin induces apoptosis in leukemia cells through inhibiting Bcl-2 family proteins SD Zhang, S Lei, LI Wei, LI Hong-Lin - Chinese journal of natural , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1875536415300637 Jacarelhyperol A induced apoptosis in leukaemia cancer cell through inhibition the activity of Bcl-2 proteins S Zhang, J Yin, X Li, J Zhang, R Yue, Y Diao, H Li - BMC cancer, 2014 - Springerhttps://link.springer.com/article/10.1186/1471-2407-14-689 Solution structure of the BHRF1 protein from Epstein-Barr virus, a homolog of human Bcl-2 Q Huang, AM Petros, HW Virgin , SW Fesik - Journal of molecular , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283603010234 Diversity Oriented Synthesis, Characterization and Anti-Cancer Activity of Killer Peptide Nucleolipid Bioconjugates NK Rana - 2017 - search.proquest.comhttps://search.proquest.com/openview/c71358671108c8599684fb2e5765817b/1?pq-origsite=gscholar&cbl=18750 Bcl-2 is a critical mediator of intestinal transformation M Van Der Heijden, CD Zimberlin - Nature , 2016 - nature.comhttps://www.nature.com/articles/ncomms10916 Toward intracellular targeted delivery of cancer therapeutics: progress and clinical outlook for brain tumor therapy H Pandya, W Debinski - BioDrugs, 2012 - Springerhttps://link.springer.com/article/10.1007/BF03261882 Comparison of chemical inhibitors of antiapoptotic Bcl-2-family proteins D Zhai, C Jin, AC Satterthwait, JC Reed - Cell Death & Differentiation, 2006 - nature.comhttps://www.nature.com/articles/4401937 A Novel Membrane-Permeable Breast-Targeting Pro-Apoptotic Peptide for Treatment of Breast Cancer B Guo, NORTH DAKOTA STATE UNIV FARGO - 2005 - apps.dtic.milhttps://apps.dtic.mil/sti/citations/tr/ADA474733 REPORT DOCUMENTATION PAGE OIMB No. 0704-0188 B Guo - 2005 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9bb8c17e31993e0a9ecc5daef286c89b42e94acc

Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

H-FIFISMILFI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FIFISMILFI-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FIFISMILFI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FIFISMILFI-OH at the technical inquiry form on this page

Pepstatin A is a natural product that inhibits the activity of proteases, particularly chymotrypsin and trypsin. It binds to the active site of these enzymes, blocking access to their substrate. Pepstatin A has been shown to have synergistic effects with other drugs in vitro, such as dapsone and clindamycin. Pepstatin A has inhibitory properties against infectious diseases, including HIV-1 and HIV-2, influenza virus type A (H1N1), herpes simplex virus type 1 (HSV-1), human papilloma virus type 18 (HPV-18), hepatitis C virus (HCV) types 1a and 1b, as well as dengue fever virus. Pepstatin A is also effective in inhibiting polymerase chain reaction amplification of mitochondrial DNA from patients with mitochondrial disorders. The biological sample for this research was obtained from calf thymus tissue. The natural compound pepstatin A has

Vps72 antibody was raised in rabbit using the N terminal of Vps72 as the immunogen

H-CGEMGWVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGEMGWVR-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGEMGWVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGEMGWVR-OH at the technical inquiry form on this page

Vesicular GABA Transporter antibody was raised in rabbit using synthetic peptide from the C-terminus of human VGAT coupled to BSA as the immunogen.

SC-26196 is a potential new anti-cancer drug that inhibits the activation of fatty acid receptors. SC-26196 blocks receptor activity, which reduces the growth of cancer cells in cell culture. This drug also has inhibitory properties on tumor growth in xenograft mice, and may be useful for the treatment of cardiac dysfunction or other diseases related to fatty acid metabolism. SC-26196 is a complex molecule with high potential for drug interactions. It is a polyunsaturated molecule that can be activated by radiation and has been shown to have cardioprotective effects in rats with myocardial infarction.

H-EVQQLSVSFSSLQIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EVQQLSVSFSSLQIK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EVQQLSVSFSSLQIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EVQQLSVSFSSLQIK-OH at the technical inquiry form on this page

Inhibitor of AKR1C3 (type 5 17β-hydroxysteroid dehydrogenase)

Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified recombinant Human SDC1 Protein (His tag)

Talampicillin is an ion channel inhibitor that binds to the ligand binding site of potassium channels. It has been shown to inhibit the activation of voltage-gated K+ channels by agonists such as acetylcholine, carbachol, and histamine. This inhibition leads to a decrease in excitability and an increase in the duration of action potentials. Talampicillin also inhibits the alpha-2A adrenergic receptor, which causes vasoconstriction and increases blood pressure. Talampicillin is used as a research tool for studying protein interactions and peptide synthesis, as well as for pharmacology studies on cell biology and antibody production.

Rabbit polyclonal CENTB1 antibody (Ser554)

Mouse anti-17-α-hydoxy progesterone monoclonal antibody

Chicken anti Human IgG secondary antibody (FITC)

Inhibitor of VEGFR; antineoplastic

Pitstop2 is a monoclonal antibody that binds to the epidermal growth factor receptor (EGFR) and inhibits cell proliferation. This drug has been shown to inhibit tumor growth in vitro, in vivo, and in clinical trials. Pitstop2 blocks the binding of epidermal growth factor to the EGFR, thereby preventing activation of the cells. Pitstop2 also prevents phosphorylation of the protein kinase B/Akt pathway, which is required for cellular proliferation and survival. The drug has been shown to be effective against a number of carcinoma cell lines and has been used to treat patients with advanced solid tumors.

Please enquire for more information about Cev (R)-S-oxide including the price, delivery time and more detailed product information at the technical inquiry form on this page

SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

Peptide H-NGLHLPSYSPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NGLHLPSYSPYPR^-OH include the following: beta-conglycinin in processed soybean products by high-performance liquid chromatography-tandem mass spectrometry with stable isotope-labeled standard peptides A Liu, L Yang, Y Yang, S Lei, Z Li, P He - Food Research International, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996923009328

Rabbit polyclonal TrkA antibody (Tyr701)

CYP2E1 antibody was raised in rabbit using a synthetic peptide as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB22 antibody, catalog no. 70R-8083

Duloxetine is a serotonin and norepinephrine reuptake inhibitor drug that is used to treat anxiety, pain, osteoarthritis and stress incontinence. This drug inhibits the reuptake of the neurotransmitters serotonin and norepinephrine so that there are increased levels of them in the synaptic cleft. Duloxetine HCl is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease

Complement C3 is a fundamental factor featured in all three complement system pathways: the classical, lectin and alternative. To activate the complement cascade C3 associates with C3 convertase to produce C3a and C3b. It is also thought that C3 can be cleaved by proteases outside of the complement cascade. C3b can bind to carbohydrate and protein hydroxyl groups through a thioester bond generated by C3 convertase cleavage. This action allows C3b to be used as a 'marker of foreign molecules such as pathogens and ultimately leads to the assembly of the membrane attack complex (MAC) and anaphylatoxin production.Overall the main functions of the complement system are to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cell by the MAC. The anaphylatoxins C3a and C5a recruit neutrophils and causes the inflammatory response while the MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.

Lidamidine is a pharmaceutical drug that is used to treat chronic diarrhea. It is a prodrug that is converted to its active form, lidocaine, in the small intestine. Lidamidine has been shown to inhibit intestinal motility and reduce the secretion of water and electrolytes into the bowel lumen. Lidamidine can be used to diagnose and treat bowel disease. The drug has an analog, mexiletine, which also inhibits intestinal motility but has greater depressant effects on cardiac function than lidamidine.

H-QEKNIMLYKGSGLWSRWK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QEKNIMLYKGSGLWSRWK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QEKNIMLYKGSGLWSRWK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QEKNIMLYKGSGLWSRWK-OH at the technical inquiry form on this page

Mouse monoclonal CTNNB1 antibody

Purified Rabbit polyclonal FOXO1A antibody (Ser322+Ser325)

CRNKL1 antibody was raised in mouse using recombinant Human Crn, Crooked Neck-Like 1 (Drosophila) (Crnkl1)

Peptide H-ELYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELYK-OH include the following: Utility of LC-MS Surrogate Peptide Methodology in the Development of a Combinectin, a Unique Anti-HIV Biologic Drug Y Benitex, J Davis, DL Wensel - J Appl , 2021 - journalofappliedbioanalysis.comhttps://journalofappliedbioanalysis.com/utility-of-lc-ms-surrogate-peptide-methodology-in-the-development-of-a-combinectin-a-unique-anti-hiv-biologic-drug/ Role of SP65 in Assembly of the Dictyostelium discoideum Spore Coat T Metcalf, H van der Wel, R Escalante , L Sastre - Eukaryotic , 2007 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/ec.00329-06 Experimental validation of plant peroxisomal targeting prediction algorithms by systematic comparison of in vivo import efficiency and in vitro PTS1 binding affinity NS Skoulding , G Chowdhary , MJ Deus, A Baker - Journal of Molecular , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283614006196 Integration of FRET and sequencing to engineer kinase biosensors from mammalian cell libraries L Liu , P Limsakul , X Meng, Y Huang - Nature , 2021 - nature.comhttps://www.nature.com/articles/s41467-021-25323-x Granulocyte-macrophage colony-stimulating factor mimicry and receptor interactions JM Von Feldt, C Monfardini, T Kieber-Emmons - Immunologic , 1994 - Springerhttps://link.springer.com/article/10.1007/BF02918271 Highly efficient green fluorescent protein-based kinase substrates F Yang, Y Liu, SD Bixby, JD Friedman, KM Shokat - Analytical biochemistry, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269798928858 Studies on protein kinases and green fluorescent protein F Yang - 1999 - search.proquest.comhttps://search.proquest.com/openview/00858785f9ca69d22ca526957ef8de82/1?pq-origsite=gscholar&cbl=18750&diss=y Substitutions in a Major Histocompatibility Complex Class II-Restricted Human Immunodeficiency Virus Type 1 gp120 Epitope Can Affect CD4+ T-Helper-Cell C Lekutis, NL Letvin - Journal of virology, 1998 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.72.7.5840-5844.1998

Lopinavir is an activator of the HIV protease that has been shown to inhibit the production of HIV-1. Lopinavir binds to the protease and blocks the breakdown of proteins, which prevents new viruses from being produced. Lopinavir also binds to receptors on cells, which activates ion channels and alters membrane potentials in cells. Lopinavir is a high-purity research tool that can be used for ligand binding studies, immunological assays, cell biology studies, or as a pharmacological agent.

Rabbit polyclonal ABCF1 antibody

L-α-phosphatidylinositol-4,5-bisphosphate is a crucial phospholipid, acting predominantly within cellular membranes. It is primarily sourced from the phosphorylation of phosphatidylinositol by specific kinases within the phosphatidylinositol pathway. This lipid is integral to the modulation of various cellular signaling cascades, particularly interacting with proteins that contain pleckstrin homology (PH) domains, thereby influencing membrane trafficking, cytoskeletal rearrangement, and signal transduction. The principal mode of action involves serving as a substrate for phospholipase C, which cleaves it to generate second messengers like inositol trisphosphate (IP3) and diacylglycerol (DAG). This cleavage is pivotal in calcium signaling and activating protein kinase C pathways. Additionally, it functions as a docking site at the plasma membrane, modulating the localization and activity of cytosolic proteins. This compound is extensively utilized in research exploring cellular processes such as signal transduction, membrane dynamics, and the regulation of ion channels. Its role is essential in understanding pathophysiological mechanisms in diseases like cancer and metabolic disorders, contributing valuable insights into therapeutic targets.

Affinity purified Rabbit polyclonal GNAS antibody

Peptide H-VNHVTLSQPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VNHVTLSQPK-OH include the following: Urinary beta2-microglobulin is associated with acute renal allograft rejection WS Oetting , TB Rogers, TP Krick, AJ Matas - American journal of , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0272638606003957 Isotope-dilution liquid chromatography-tandem mass spectrometry method for serum beta 2-microglobulin quantification S Yang, X Tian, Y Chen, L Shen, J Wang - Journal of Chromatography B, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023222003919 Identification of beta2-microglobulin as a urinary biomarker for chronic allograft nephropathy using proteomic methods O Johnston, H Cassidy , S O'Connell - PROTEOMICS , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201000160 Orthologous proteins of experimental de-and remyelination are differentially regulated in the CSF proteome of multiple sclerosis subtypes NA Martin, A Nawrocki, V Molnar , ML Elkjaer - PloS one, 2018 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0202530 Exploring the interaction of cisplatin with beta2-microglobulin: new insights into a chemotherapeutic drug N Zhang, M Cui, Y Du, Z Liu, S Liu - RSC Advances, 2014 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2014/ra/c3ra44096f The effect of histidine oxidation on the dissociation patterns of peptide ions JD Bridgewater, R Srikanth , J Lim - Journal of the American , 2007 - Springerhttps://link.springer.com/article/10.1016/j.jasms.2006.11.001 Analytical validation of protein biomarkers for risk of spontaneous preterm birth C Bradford, R Severinsen, T Pugmire - Clinical Mass , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2376999817300119

STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI

hnRNP U/p120 Monoclonal Antibody

Purified Hamster IgG HRP conjugate

Peptide H-VVFGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVFGAR^-OH include the following: Cloning and expression of the Haemophilus influenzae transferrin receptor genes SM Loosmore, Y Yang, DC Coleman - Molecular , 1996 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1046/j.1365-2958.1996.406943.x

Rabbit polyclonal SIVA1 antibody

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

H-LAKKSIHPDYVITTQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAKKSIHPDYVITTQ-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAKKSIHPDYVITTQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAKKSIHPDYVITTQ-OH at the technical inquiry form on this page

PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA

Purified recombinant APOL4 protein (His tag)

Peptide H-EIVDSYLPVILDIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EIVDSYLPVILDIIK-OH include the following: Proteomic profiling of human urinary proteome using nano-high performance liquid chromatography/electrospray ionization tandem mass spectrometry YC Tyan, HR Guo, CY Liu, PC Liao - Analytica Chimica Acta, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267006015492 Mining of serum glycoproteins by an indirect approach using cell line secretome Y Ahn, UB Kang, J Kim, C Lee - Molecules and cells, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1016847823129682 The identification of new biomarkers for identifying and monitoring kidney disease and their translation into a rapid mass spectrometry-based test: evidence of V Manwaring, WE Heywood , R Clayton - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr301200e Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation M Yamamoto-Tanaka, A Motoyama, M Miyai - Journal of Biological , 2014 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)47653-7/abstract Urine proteome of autosomal dominant polycystic kidney disease patients M Bakun, M Niemczyk, D Domanski , R Jazwiec - Clinical proteomics, 2012 - Springerhttps://link.springer.com/article/10.1186/1559-0275-9-13

Rabbit polyclonal Orosomucoid antibody (biotin)

This antibody reacts with heavy (gamma) chains on human IgG and light chains on all human immunoglobulins.

A synthetic peptide for use as a blocking control in assays to test for specificity of HFE antibody, catalog no. 70R-5984

Peptide H-KASEKIFYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KASEKIFYV-OH include the following: The use of positional scanning synthetic combinatorial libraries (PS-SCL) to study T Lympohcyte specificity and degeneracy V Rubio-Godoy - 2002 - core.ac.ukhttps://core.ac.uk/download/pdf/18168125.pdf Combinatorial peptide library-based identification of peptide ligands for tumor-reactive cytolytic T lymphocytes of unknown specificity V Rubio-Godoy, M Ayyoub, V Dutoit - European journal of , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1521-4141(200208)32:8%3C2292::AID-IMMU2292%3E3.0.CO;2-K Proteasome-Assisted Identification of TRCTLI Metastatic - J Immunol, 2002 - researchgate.nethttps://www.researchgate.net/profile/Danila-Valmori-2/publication/11535787_Proteasome-Assisted_Identification_of_a_SSX-2-Derived_Epitope_Recognized_by_Tumor-Reactive_CTL_Infiltrating_Metastatic_Melanoma/links/5f168594a6fdcc3ed71b36c7/Proteasome-Assisted-Identification-of-a-SSX-2-Derived-Epitope-Recognized-by-Tumor-Reactive-CTL-Infiltrating-Metastatic-Melanoma.pdf Novel TCR-like CAR-T cells targeting an HLA∗ 0201-restricted SSX2 epitope display strong activity against acute myeloid leukemia S Raskin, S Van Pelt, K Toner , PB Balakrishnan - Therapy-Methods & , 2021 - cell.comhttps://www.cell.com/molecular-therapy-family/methods/fulltext/S2329-0501(21)00146-7?elqTrackId=ae3d3c18d29343bda912fab5bc7c9424 Simultaneous ex vivo quantification of antigen-specific CD4+ and CD8+ T cell responses using in vitro transcribed RNA S Kreiter , T Konrad, M Sester , C Huber, aca– Tureci - Cancer immunology , 2007 - Springerhttps://link.springer.com/article/10.1007/s00262-007-0302-7 Increased antigen presentation efficiency by coupling antigens to MHC class I trafficking signals S Kreiter , A Selmi, M Diken , M Sebastian - The Journal of , 2008 - journals.aai.orghttps://journals.aai.org/jimmunol/article/180/1/309/78384 Proteasome-assisted identification of a SSX-2-derived epitope recognized by tumor-reactive CTL infiltrating metastatic melanoma M Ayyoub, S Stevanovic, U Sahin - The Journal of , 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/168/4/1717/34774 Defective Interferon Gamma Production by Tumor-Specific CD8+ T Cells Is Associated With 5'Methylcytosine-Guanine Hypermethylation of Interferon Gamma M Abd Hamid, X Yao, C Waugh - Frontiers in , 2020 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2020.00310/full Multivalent immunity targeting tumor-associated antigens by intra-lymph node DNA-prime, peptide-boost vaccination KA Smith, Z Qiu, R Wong, VL Tam, BL Tam - Cancer Gene , 2011 - nature.comhttps://www.nature.com/articles/cgt201045 227. Efficient Eradication of Castration-Resistant Human Prostate Cancers by Inactivated Sendai Virus Particle K Hatano, Y Kawaguchi, Y Miyamoto, N Nonomura - Molecular Therapy, 2011 - cell.comhttps://www.cell.com/molecular-therapy-family/molecular-therapy/fulltext/S1525-0016(16)36800-9 SSX expression in gynecological cancers and antibody response in patients K Hasegawa, F Koizumi, Y Noguchi, A Hongo - Cancer Immunity, 2004 - AACRhttps://aacrjournals.org/cancerimmun/article-abstract/4/1/16/472242 Impact of 3 different short-term chemotherapy regimens on lymphocyte-depletion and reconstitution in melanoma patients J Laurent, DE Speiser , V Appay, C Touvrey - Journal of , 2010 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2010/09000/Impact_of_3_Different_Short_term_Chemotherapy.00009.aspx Cancer-associated antigens and their clinical potential for immunotherapy J Ganapathy , VV Prabhu - Malaya Journal of Biosciences. Journal , 2016 - researchgate.nethttps://www.researchgate.net/profile/Vinod-Prabhu-3/publication/312088973_Cancer-associated_antigens_and_their_clinical_potential_for_immunotherapy/links/586ee12f08ae8fce491ca37a/Cancer-associated-antigens-and-their-clinical-potential-for-immunotherapy.pdf Peptides for vaccine development IW Hamley - ACS Applied Bio Materials, 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsabm.1c01238 Vaccines targeting the cancer-testis antigen SSX-2 elicit HLA-A2 epitope-specific cytolytic T cells HA Smith , DG McNeel - Journal of Immunotherapy, 2011 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2011/10000/Vaccines_Targeting_the_Cancer_testis_Antigen_SSX_2.1.aspx The SSX family of cancer-testis antigens as target proteins for tumor therapy HA Smith , DG McNeel - Journal of Immunology Research, 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/full/10.1155/2010/150591 Evaluating the SSX Family of Cancer-Testis Antigens as Immunological Targets for the Treatment of Prostate Cancer H Smith - 1912 - asset.library.wisc.eduhttps://asset.library.wisc.edu/1711.dl/3Q3NIGU7BLH5S84/R/file-6c18f.pdf Development of a T cell receptor targeting an HLA-A* 0201 restricted epitope from the cancer-testis antigen SSX2 for adoptive immunotherapy of cancer D Abate-Daga, DE Speiser , N Chinnasamy, Z Zheng - PloS one, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0093321

Recombinant Human SFRP5 protein (His tag)

CPVL antibody was raised in Rabbit using Human CPVL as the immunogen

H-EDLLALR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EDLLALR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EDLLALR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EDLLALR-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO8 antibody, catalog no. 70R-3127

Affinity purified Rat polyclonal CD104 antibody

Mouse monoclonal TOMM34 antibody

TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Rabbit polyclonal PLCG2 antibody

Purified recombinant Human TNFRSF17 protein (His tag)

HDHD3 antibody was raised in Rabbit using Human HDHD3 as the immunogen

SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIVmac251) produced in baculovirus expression system as the immunogen.

PSEM 89S is a synthetic compound that has been shown to activate the Ca2+ response and glutamate release from nerve cells. It also has antiviral properties and may be useful in treating virus-induced neuronal damage. PSEM 89S has been shown to have pharmacological effects on neurons and brain cells, as well as protecting against nerve injury. This drug has also been shown to increase the number of activated ganglion cells in the brain.

H-SGLPHNSSANSTETLQHVPS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGLPHNSSANSTETLQHVPS-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGLPHNSSANSTETLQHVPS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGLPHNSSANSTETLQHVPS-OH at the technical inquiry form on this page

N-(11H-Indolo[3,2-c]quinolin-6-yl)-N,N-dimethylethane-1,2-diamine is a potent inhibitor of the enzyme adenosine deaminase. It is a pharmacological tool for research on the study of protein interactions and receptor activation. N-(11H-Indolo[3,2-c]quinolin-6-yl)-N,N-dimethylethane-1,2-diamine is also used as a ligand in the study of ion channels.

Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.

A synthetic peptide for use as a blocking control in assays to test for specificity of NUDCD1 antibody, catalog no. 70R-2692

Rabbit polyclonal SMO antibody

Purified recombinant HIV2 p26 ROD (FITC)

Peptide H-ALIRILQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALIRILQQL-OH include the following: The majority of currently circulating human immunodeficiency virus type 1 clade B viruses fail to prime cytotoxic T-lymphocyte responses against an otherwise M Altfeld, TM Allen , ET Kalife, N Frahm - Journal of , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.79.8.5000-5005.2005 Prediction of neo-epitope immunogenicity reveals TCR recognition determinants and provides insight into immunoediting J Schmidt, AR Smith, M Magnin, J Racle , JR Devlin - Cell Reports , 2021 - cell.comhttps://www.cell.com/cell-reports-medicine/pdf/S2666-3791(21)00005-7.pdf

Peptide H-KLLGPHVLGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KLLGPHVLGV-OH include the following: Rapid and Reliable Peptide de Novo Sequencing Facilitated by Microfluidic Chip-Based Edman Degradation W Chen, X Yin, Y Yin - Journal of Proteome Research, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr070465p

Pirlindole is a reversible inhibitor of cholinesterase that is used for the treatment of infectious diseases. Pirlindole is an acetylcholine esterase inhibitor and has been shown to inhibit growth factor-induced cell proliferation in human cancer cells. It has also been shown to have antiviral activity against certain viruses such as herpes simplex virus types 1 and 2, vesicular stomatitis virus, reovirus type 3, and influenza A virus. Pirlindole has also been found to have anti-inflammatory properties because it inhibits prostaglandin synthesis.

A synthetic peptide for use as a blocking control in assays to test for specificity of DVL1 antibody, catalog no. 70R-1639

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit polyclonal USP20 antibody

Rabbit polyclonal CD45 antibody

Rabbit polyclonal MARCHV antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ASNA1 antibody, catalog no. 70R-10011

Catalogue peptide; min. 95% purity

CD62L antibody (Azide Free) was raised in Rat using C3H/eb cloned mouse B lymphoma 38C-13 as the immunogen.

H-LIKGGVEVL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LIKGGVEVL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LIKGGVEVL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LIKGGVEVL-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD1 antibody, catalog no. 70R-4346

GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI

Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal NUCB1 antibody

Rabbit polyclonal HSF1 antibody

Catalogue peptide; min. 95% purity

Ovalbumin 154-159, also nammed TNGIIR peptide, is a portion of interest of the egg white albumen. Anti-hypertensive activity TNGIIR peptide has been described to have a protective activity on the blood pressure by inhibiting the Angiotensin-Converting Enzyme (ACE). The concentration of the peptide, necessary to inhibit 50% of the activity of ACE, was 70 μM. Involvement in Alzheimer’s disease Ovalbumin 154-159 peptide demonstrated recently an activity against Acetylcholinesterase (AchE), which is implicated in Alzheimer’s diseases. Actually, a deficiency in the brain levels of acetylcholine is seen as key step in the pathogenesis of Alzheimer disease. Otherwise, Ovalbumin 154-159 seems to be involved in a possible inhibition of beta-site APP clieaving enzyme 1 (BACE1), which is one of the most promising new therapeutic approaches for Alzheimer’s diseases. Indeed, this receptor induce the formation of Amyloid Beta, a typical peptide from Alzheimer’s diseases.

Affinity purified Rabbit polyclonal Ephrin A1 antibody

H-CSGKLICTTTVPWNS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CSGKLICTTTVPWNS-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CSGKLICTTTVPWNS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CSGKLICTTTVPWNS-OH at the technical inquiry form on this page

Purified Polyclonal Vimentin antibody

Rabbit polyclonal PGK1 antibody (biotin)

TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR

Mouse monoclonal COX6A1 antibody

ELISA kit for detection of ACTH in the research laboratory

FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV

Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA

AKT1 antibody was raised in Rabbit using Human AKT1 as the immunogen

The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.

Purified Recombinant Cadherin 5 protein (His tagged)

Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.

Human sequence expressed in sf Insect Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

AP3S1 antibody was raised in rabbit using the C terminal of AP3S1 as the immunogen

LCAT antibody was raised using the N terminal of LCAT corresponding to a region with amino acids MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

p-Gp inhibitor 1 is a peptide that inhibits the activity of G protein. This peptide is used as a research tool to study protein interactions, antibody production and cell biology. p-Gp inhibitor 1 can be used in pharmacology to inhibit the activity of G proteins. It also has been shown to have an effect on ion channels by inhibiting the opening of sodium ion channels, which may lead to potential therapeutic applications for conditions such as epilepsy. The purity of this peptide is high and it has been shown to be an activator of G proteins.

Peptide H-QGGFLGLSNIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QGGFLGLSNIK-OH include the following: Targeted proteomics of plasma extracellular vesicles uncovers MUC1 as combinatorial biomarker for the early detection of high-grade serous ovarian cancer TT Cooper , DZ Dieters-Castator , J Liu- Journal of Ovarian ..., 2024 - Springerhttps://link.springer.com/article/10.1186/s13048-024-01471-8

Antagonist of D1-like dopamine receptor subtypes, D1 and D5 (Ki values 0.2 and 0.3 nM respectively). Agonist of serotonin receptors 5-HT1C and 5-HT2C (Ki values 6.3 nM and 9.3 nM respectively). Used to study the topography of D1 receptors in humans and animals. Reduces seizures in response to chemoconvulsants and has also been studied in other neurological disorders.

Peptide H-TTGDPPFPGQPPPVANDTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TTGDPPFPGQPPPVANDTR^-OH include the following: Second generation multiple reaction monitoring assays for enhanced detection of ultra-low abundance Mycobacterium tuberculosis peptides in human serum C Mehaffy , KM Dobos , P Nahid , NA Kruh-Garcia - Clinical proteomics, 2017 - Springerhttps://link.springer.com/article/10.1186/s12014-017-9156-y

Ac-RMGIKTSEGTPGC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RMGIKTSEGTPGC-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RMGIKTSEGTPGC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RMGIKTSEGTPGC-NH2 at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of AGGF1 antibody, catalog no. 70R-3986

The Pancreatic Polypeptide antibody is a highly specialized monoclonal antibody that is designed to target and neutralize pancreatic polypeptide, a glycoprotein hormone secreted by the pancreas. This antibody has been extensively researched and proven to have cytotoxic effects on cells that express high levels of pancreatic polypeptide, making it a valuable tool in life sciences research. In addition to its cytotoxic properties, this monoclonal antibody has also been shown to have anti-connexin activity, which means it can disrupt the communication between cells mediated by connexin proteins. This disruption can be beneficial in certain disease conditions where excessive cell-to-cell communication is detrimental. Furthermore, this antibody has demonstrated its efficacy as an anti-angiogenic agent by inhibiting the endothelial growth factor and chemokine signaling pathways involved in angiogenesis. This makes it a promising candidate for the treatment of diseases characterized by abnormal blood vessel formation, such as cancer. The Pancreatic Polypeptide antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO24 antibody, catalog no. 70R-2811

Histone H3 (1 - 20) K4Me3 is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation.  The modification pattern is believed to alter chromatin function/structure.  Lysine 4 of histone H3 (1 - 20) K4Me3 has been tri-methylated, lysine 9 has been acetylated, and serine 10 has been phosphorylated and labelled with Biotin. This peptide can be used to study the function of this pattern on chromatin availability and histone effectors via crystallisation, pull-down assays and protein blots.

Purified Polyclonal GCFC2 antibody

Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ

Mouse monoclonal HSP60 antibody

DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Mouse monoclonal BCAT1 antibody

H-YEQYSGDIR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YEQYSGDIR-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YEQYSGDIR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YEQYSGDIR-OH at the technical inquiry form on this page

Mouse monoclonal PRPS1 antibody

NPE-caged-HPTS is a photoreactive fluorescent pH indicator, which is a synthetic compound with a precisely engineered molecular structure. Its source originates from organic chemistry laboratories specializing in the development of photolabile caged compounds. The mode of action involves a photochemical reaction induced by ultraviolet light, which cleaves the caging group, releasing the active form of the pH-sensitive fluorescent dye, 8-hydroxypyrene-1,3,6-trisulfonic acid (HPTS). In scientific applications, NPE-caged-HPTS is prominently used in the study of cellular environments and pH-dependent biochemical processes. It is valuable for investigating intracellular pH dynamics and for mapping cellular compartments under various physiological conditions. By allowing precise spatial and temporal control over the activation of fluorescence, researchers can observe real-time changes within live cells or complex biological systems. This compound is thus critical in experiments requiring high-resolution pH measurement and in studies of pH-mediated signaling pathways, offering significant insights into cellular function and biochemical interactions.