Biochemicals and Reagents

The Cortisol antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets cortisol, a hormone involved in stress response and regulation of various physiological processes. This antibody enables the detection and measurement of cortisol concentration in biological samples. The Cortisol antibody works by forming an antigen-antibody reaction with cortisol molecules present in the sample. This reaction produces a measurable signal, which can be analyzed using techniques such as electrophoresis or immunoassays. The antibody has been extensively tested and validated for its specificity and sensitivity, ensuring accurate and reliable results. One of the key applications of the Cortisol antibody is in studying the role of cortisol in various biological processes. It can be used to investigate the effects of stress on cortisol levels, as well as its involvement in conditions such as depression, anxiety, and adrenal disorders. Researchers can also use this antibody to study the interactions between cortisol and other molecules, such as dopamine or interleukin-6.

Peptide H-WMHHNMLDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WMHHNMLDI-OH include the following: Peptide-MHC Class I Cytotoxic Tetramers Inhibit Specific CTL Activity and Alter Immunodominance Hierarchies in the HY Antigen System. S Murray - 2010 - repository.lib.ncsu.eduhttps://repository.lib.ncsu.edu/bitstream/1840.16/6602/1/etd.pdf Bystander IFN-γ activity promotes widespread and sustained cytokine signaling altering the tumor microenvironment R Thibaut, P Bost , I Milo, M Cazaux, F Lemaaca®tre - Nature cancer, 2020 - nature.comhttps://www.nature.com/articles/s43018-020-0038-2 Expansion of CD8+ Cytotoxic T Cells in vitro and in vivo Using MHC Class I Tetramers PSMMS Dimokoub, J Stebbingc, J Dysonb - Tumor Biol, 2006 - researchgate.nethttps://www.researchgate.net/profile/Philip-Savage-2/publication/6539064_Expansion_of_CD8_Cytotoxic_T_Cells_in_vitro_and_in_vivo_Using_MHC_Class_I_Tetramers/links/54da70dd0cf233119bc3404e/Expansion-of-CD8-Cytotoxic-T-Cells-in-vitro-and-in-vivo-Using-MHC-Class-I-Tetramers.pdf Expansion of CD8+ cytotoxic T cells in vitro and in vivo using MHC class I tetramers P Savage , M Millrain, S Dimakou, J Stebbing , J Dyson - Tumor Biology, 2007 - karger.comhttps://karger.com/tbi/article-abstract/28/2/70/300147 Examination of HY response: T cell expansion, immunodominance, and cross-priming revealed by HY tetramer analysis M Millrain, P Chandler, F Dazzi , D Scott - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/167/7/3756/83566 The immune system profoundly restricts intratumor genetic heterogeneity I Milo, M Bedora-Faure, Z Garcia, R Thibaut - Science , 2018 - science.orghttps://www.science.org/doi/abs/10.1126/sciimmunol.aat1435 L'immunodominance resulte d'une competition entre les populations lymphocytaires T CD8⁺ reconnaissant differents antigacašnes G Roy-Proulx - 2007 - papyrus.bib.umontreal.cahttps://papyrus.bib.umontreal.ca/xmlui/bitstream/handle/1866/15379/Roy-Proulx_Guillaume_2006_these.pdf?sequence=1 EBAG9 controls CD8+ T cell memory formation responding to tumor challenge in mice A Rehm, A Wirges, D Hoser, C Fischer, S Herda - JCI insight, 2022 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC9220939/

Peptide H-AKAKAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AKAKAK-OH include the following: Surface-enhanced Raman scattering-based detection of plasmin activity by specific peptide substrate NN Yazgan , T Bulat, A Topcu , FC Dudak , IH Boyaci - Food Chemistry, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S030881462102241X Introduction to peptide science IW Hamley - 2020 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=RwXtDwAAQBAJ&oi=fnd&pg=PP7&dq=(%22AKAKAK%22+OR+%22H-AKAKAK-OH%22+OR+%22NH2-Ala-Lys-Ala-Lys-Ala-Lys-OH%22)+AND+peptide&ots=B-QXaCuEUm&sig=dCWknm0F6oOYB7GXCYn97GsS_FU

Please enquire for more information about Nintedanib ethanesulfonate including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-RPARPAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RPARPAR-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RPARPAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RPARPAR-OH at the technical inquiry form on this page

ANKRD37 antibody was raised using the middle region of ANKRD37 corresponding to a region with amino acids GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK

CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.

Rabbit polyclonal PITX1 antibody

Affinity purified Mouse polyclonal EPHB3 antibody

Purified recombinant Human C4BPB protein (His tag)

H-SEIWRDIDF-OH peptide, corresponding to amino acids 192-200 of human and mouse Tyrosinase. The peptide is supplied as an acetate salt.

Mouse monoclonal PSMA4 antibody

KIF5B antibody was raised using the N terminal of KIF5B corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Please enquire for more information about Peanut Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of NUP98 antibody, catalog no. 70R-5608

Mouse monoclonal NP antibody

Mouse monoclonal GFAP antibody

Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.

FOP antibody was raised in Rat using Mouse Friend of Prmt1 C-terminus and GST fusion protein as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L3 antibody, catalog no. 70R-3085

H-FICPLTGLWPINTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FICPLTGLWPINTLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FICPLTGLWPINTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FICPLTGLWPINTLK-OH at the technical inquiry form on this page

Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SHGQDYLVGNK^-OH include the following: Quantitation of human glutathione S-transferases in complex matrices by liquid chromatography/tandem mass spectrometry with signature peptides F Zhang, MJ Bartels, WT Stott - Rapid communications in mass , 2004 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1364

Inhibits human and mouse diacylglycerol O-acyltransferase 1 (DGAT-1) with IC50 values of 9 and 22 nM, respectively. Selective for DGAT-1 over DGAT-2 (IC50 = 53 µM), acyl coenzyme A transferase (IC50 = 296 µM) and other acyltransferases. Reduces plasma and liver triglycerides, FFA, chylomicron secretion and increases HDL cholesterol in vivo.

Catalogue peptide; min. 95% purity

Research tool for the study of protein-protein interactions. Hsp40, gst tagged human is an inhibitor that binds to and inhibits the activity of Hsp70, which is a heat shock protein that protects cells from heat stress. The product has been shown to inhibit ion channels, ligand-gated receptors, and peptide receptors. It also has been shown to activate certain proteins such as Hsp90 and GstP1.

PDE8B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

H-D-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is an amino acid resin with D,L-alanyl side chains, which can be cleaved by hydrochloric acid to release the desired amino acid and trityl resin. This resin is used in peptide synthesis reactions to provide a protecting group for the N-terminal amino acid.

Mouse monoclonal Fibronectin antibody

Rabbit polyclonal RPL17 antibody

Rabbit polyclonal CREB antibody

Peptide H-AADDTWEPFASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AADDTWEPFASGK^-OH include the following: A multiplex protein panel assay determines disease severity and is prognostic about outcome in COVID-19 patients Z Wang , A Cryar, O Lemke, D Ludwig, P Tober-Lau - medRxiv, 2021 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2021.12.03.21267253.abstract Analytical performance of nano-LC-SRM using nondepleted human plasma over an 18-month period X Song, A Amirkhani , JX Wu , D Pascovici , T Zaw - , 2016 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201500507 Discovering known and unanticipated protein modifications using MS/MS database searching WH Tang, BR Halpern, IV Shilov , SL Seymour - Analytical , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac0481046 Biomarker Detection in Urinary Proteome of Prostate Cancer by Nanoflow LC-MS/MS LV Autus-Geniston, CP Garcia - Acta Medica , 2013 - actamedicaphilippina.upm.edu.phhttps://actamedicaphilippina.upm.edu.ph/index.php/acta/article/download/1357/1195 The relative amounts of plasma transthyretin forms in familial transthyretin amyloidosis: a quantitative analysis by Fourier transform ion-cyclotron resonance mass C Ribeiro-Silva, S Gilberto, RA Gomes , aca‰ Mateus - Amyloid, 2011 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.3109/13506129.2011.614295

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

Beta Galactosidase antibody was raised in chicken using beta galactosidase from E coli as the immunogen.

CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Chimeric monoclonal antibody targeting E. coli shiga toxin type-2

Peptide H-CMYIEALDKYAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CMYIEALDKYAC-OH include the following: Targeting drug delivery system for platinum (â £)-Based antitumor complexes Y Zhong, C Jia, X Zhang, X Liao, B Yang - European Journal of , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523420301963 Targeted delivery of doxorubicin through conjugation with EGF receptor-binding peptide overcomes drug resistance in human colon cancer cells S Ai, T Jia, W Ai , J Duan, Y Liu, J Chen - British Journal of , 2013 - Wiley Online Libraryhttps://bpspubs.onlinelibrary.wiley.com/doi/abs/10.1111/bph.12055 Homing peptides for cancer therapy P Lingasamy , T Teesalu - Bio-nanomedicine for cancer therapy, 2021 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-58174-9_2 Peptide-drug conjugates: A new paradigm for targeted cancer therapy M Wang, J Liu, M Xia, L Yin, L Zhang, X Liu - European Journal of , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523423010863 A Tumor-Targeting Dual-Stimuli-Activatable Photodynamic Molecular Beacon for Precise Photodynamic Therapy LKB Tam , L He, DKP Ng - -A European Journal, 2022 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/chem.202201652 "œClick" for precise photodynamic therapy LKB Tam , DKP Ng - Materials Chemistry Frontiers, 2023 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2014/gv/d3qm00431g EGFR-Targeted Photodynamic Ther-apy. Pharmaceutics 2022, 14, 241 L Ulfo, PE Costantini, M Di Giosia, A Danielli - 2022 - researchgate.nethttps://www.researchgate.net/profile/Matteo-Di-Giosia/publication/357969829_EGFR-Targeted_Photodynamic_Therapy/links/61e995e2c5e3103375ab15b0/EGFR-Targeted-Photodynamic-Therapy.pdf EGFR-targeted photodynamic therapy L Ulfo, PE Costantini, M Di Giosia , A Danielli - Pharmaceutics, 2022 - mdpi.comhttps://www.mdpi.com/1999-4923/14/2/241 Sense-antisense complementarity in protein-protein interaction sites JW Slootstra¹, EW Roubos - Antisense nucleic acids and proteins , 1991 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=g4wIR3q_gBoC&oi=fnd&pg=PA205&dq=(%22H-CMYIEALDKYAC-OH%22+OR+%22CMYIEALDKYAC%22)+AND+peptide&ots=7xZpyKhDtR&sig=fTQEfm3z9wgNaff-FnIWxq-TBAM Facile synthesis of cyclic peptide-phthalocyanine conjugates for epidermal growth factor receptor-targeted photodynamic therapy JCH Chu , WP Fong, CTT Wong - Journal of Medicinal , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.0c01677 EGFR-targeting peptide-coupled platinum (IV) complexes J Mayr, S Hager, B Koblmuller, MHM Klose - JBIC Journal of , 2017 - Springerhttps://link.springer.com/article/10.1007/s00775-017-1450-7 Three dimensional projection environment for molecular design and surgical simulation E Wickstrom, CP Chen, D Devadhas - Meets Virtual Reality , 2011 - ebooks.iospress.nlhttps://ebooks.iospress.nl/volumearticle/13843 Design, synthesis, and activity assay of functionalized Epidermal Growth Factor Receptor ligands as anticancer candidate for NSCLC DH Tjahjono - Report of Grant-Supported Research The Asahi Glass , 2022 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/afreport/91/0/91_2022_113/_article/-char/ja/ Development of Cyclic Peptide-Conjugated Photosensitizers for Targeted Photodynamic Therapy CH Chu - 2021 - search.proquest.comhttps://search.proquest.com/openview/179cc928f6befee9f0d6e12865ef6176/1?pq-origsite=gscholar&cbl=2026366&diss=y FDG-EGF-frag (18F): development, characterization and dosimetric evaluation ACA Bispo - inis.iaea.orghttps://inis.iaea.org/search/search.aspx?orig_q=RN:54054474 Phage in cancer treatment-Biology of therapeutic phage and screening of tumor targeting peptide AC Manivannan, R Dhandapani - Expert Opinion on , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/17425247.2022.2094363

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Recombinant human POLB protein

Biotin-dPEG®3-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®3-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Mouse monoclonal NEK6 antibody

1-100 amino acids: MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY

Mouse Anti Mullerian Hormone antibody

H-LQLSETNR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LQLSETNR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LQLSETNR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LQLSETNR-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT7 antibody, catalog no. 70R-2930

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087

Recombinant Human SGCB protein with His tag

Rabbit polyclonal LPHN1 antibody

Purified native Mouse IgG

Peptide H-FNWYVDGVEVHNAKTKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FNWYVDGVEVHNAKTKPR^-OH include the following: A novel filter-assisted protein precipitation (FAPP) based sample pre-treatment method for LC-MS peptide mapping for biosimilar characterization S Bhattacharya , AS Rathore - Journal of Pharmaceutical and Biomedical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708523002960

Purified recombinant CXCL4 protein (His tag)

Please enquire for more information about Cyperin including the price, delivery time and more detailed product information at the technical inquiry form on this page

SERPINE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA

Peptide H-KLTWQELYQLK^YKGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KLTWQELYQLK^YKGI-OH include the following: Development of VEGF mimetic QK peptide on polycaprolactone nanofiber for vascular tissue engineering ZBY aca‡evik , G Sunal, A TaÃ…Åžkara, O Karaman - Materials Today , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2352492824010079 Designer self-assembling peptide hydrogels to engineer 3D cell microenvironments for cell constructs formation and precise oncology remodeling in ovarian cancer Z Yang, H Xu, X Zhao - Advanced Science, 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/advs.201903718 Vascularized polypeptide hydrogel modulates macrophage polarization for wound healing Z Chen, L Wang, C Guo, M Qiu, L Cheng, K Chen, J Qi - Acta Biomaterialia, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1742706122007279 Designer functionalized self-assembling peptide nanofiber scaffolds for growth, migration, and tubulogenesis of human umbilical vein endothelial cells X Wang, A Horii, S Zhang - Soft Matter, 2008 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2008/sm/b807155a In vivo studies on angiogenic activity of two designer self-assembling peptide scaffold hydrogels in the chicken embryo chorioallantoic membrane X Liu , X Wang, A Horii, X Wang, L Qiao, S Zhang - Nanoscale, 2012 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2012/nr/c2nr00001f Polymer-peptide Conjugates as Mimetics of Erythropoietin and Vascular Endothelial Growth Factor T Mahon - 2020 - search.proquest.comhttps://search.proquest.com/openview/012a62f6b1d062428c9856566f088184/1?pq-origsite=gscholar&cbl=18750&diss=y Release systems based on self-assembling RADA16-I hydrogels with a signal sequence which improves wound healing processes S Rodziewicz-MotowidÅ‚o, M DzierÃ…ÂŒyÅ„ska , J Sawicka - 2022 - chemrxiv.orghttps://chemrxiv.org/engage/chemrxiv/article-details/639a33a7ff465105672a9ea8 A matrix metalloproteinase-responsive hydrogel system controls angiogenic peptide release for repair of cerebral ischemia/reperfusion injury Q Liu, J Xie, R Zhou, J Deng, W Nie, S Sun - Neural Regeneration , 2025 - journals.lww.comhttps://journals.lww.com/nrronline/fulltext/2025/02000/a_matrix_metalloproteinase_responsive_hydrogel.28.aspx Self-assembling peptides: potential role in tumor targeting P Sadatmousavi , M Soltani , R Nazarian - Current , 2011 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cpb/2011/00000012/00000008/art00002 Synergistic effects of dual-presenting VEGF-and BDNF-mimetic peptide epitopes from self-assembling peptide hydrogels on peripheral nerve regeneration J Lu, X Yan, X Sun, X Shen, H Yin, C Wang, Y Liu, C Lu - Nanoscale, 2019 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2019/nr/c9nr04521j Biomimetic self-assembling peptide hydrogels for tissue engineering applications J Lu, X Wang - Biomimetic Medical Materials: From Nanotechnology to , 2018 - Springerhttps://link.springer.com/chapter/10.1007/978-981-13-0445-3_18 Enhanced angiogenesis by the hyaluronic acid hydrogels immobilized with a VEGF mimetic peptide in a traumatic brain injury model in rats J Lu, F Guan, F Cui, X Sun, L Zhao - Regenerative , 2019 - academic.oup.comhttps://academic.oup.com/rb/article-abstract/6/6/325/5543860 Multivalent display of chemical signals on self-assembled peptide scaffolds HE Distaffen , CW Jones, BL Abraham - Peptide , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/pep2.24224 Molecular dynamics simulations of biological macromolecules: applications to structural vaccinology and peptide design G Scarabelli - 2010 - air.unimi.ithttps://air.unimi.it/handle/2434/150154 Protease-Sensitive, VEGF-Mimetic Peptide, and IKVAV Laminin-Derived Peptide Sequences within Elastin-Like Recombinamer Scaffolds Provide Spatiotemporally F Gonzalez-Perez , M Alonso - Advanced , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adhm.202201646 The powerful functions of peptide-based bioactive matrices for regenerative medicine CM Rubert Perez , N Stephanopoulos , S Sur - Annals of biomedical , 2015 - Springerhttps://link.springer.com/article/10.1007/s10439-014-1166-6

Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal Mitotic Cells antibody

Please enquire for more information about (-)-Normacromerine-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant Human RBM8A protein

H-TKEGVLYVGSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TKEGVLYVGSK-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TKEGVLYVGSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TKEGVLYVGSK-OH at the technical inquiry form on this page

Peptide Ac-YPYDVPDYAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-YPYDVPDYAC-OH include the following: A Novel Extracytoplasmic Function (ECF) Sigma Factor Regulates Virulence in MA Llamas, A van der Sar, BCH Chu, M Sparrius - 2009 - scienceopen.comhttps://www.scienceopen.com/document_file/79307558-aa1d-48e8-b75c-18d3cf605e19/PubMedCentral/79307558-aa1d-48e8-b75c-18d3cf605e19.pdf A Novel Extracytoplasmic Function (ECF) Sigma Factor Regulates Virulence in Pseudomonas aeruginosa MA Llamas , A van der Sar , BCH Chu, M Sparrius - PLoS , 2009 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1000572 PRMT1 mediated methylation of TAF15 is required for its positive gene regulatory function L Jobert, M Argentini, L Tora - Experimental cell research, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014482708005181 Hemagglutinin linear epitope presentation on monolayer-protected clusters elicits strong antibody binding AE Gerdon , DW Wright , DE Cliffel - Biomacromolecules, 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bm050475o

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Coxiella Burnetti (Q-fever) Phase 2 IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Coxiella Burnetti (Q-fever) Phase 2 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-GWGSFFKKAAHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GWGSFFKKAAHV-OH include the following: Influence of the hydrophobic amino acids in the N-and C-terminal regions of pleurocidin on antifungal activity JY Lee, DG Lee - Journal of microbiology and biotechnology, 2010 - koreascience.krhttps://koreascience.kr/article/JAKO201018860405296.page Influence of the N-and C-terminal regions of antimicrobial peptide pleurocidin on antibacterial activity J Cho, H Choi, DG Lee - Journal of microbiology and , 2012 - koreascience.krhttps://koreascience.kr/article/JAKO201213660554892.page

A synthetic peptide for use as a blocking control in assays to test for specificity of PI3 antibody, catalog no. 70R-7381

NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)

Please enquire for more information about Aszonapyrone A including the price, delivery time and more detailed product information at the technical inquiry form on this page

ATM kinase inhibitor; glioma radiosensitizer; DDR transduction kinase inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of STRAP antibody, catalog no. 70R-1056

RANTES antibody was raised in rabbit using highly pure recombinant rat RANTES as the immunogen.

L-azidoleucine CHA salt

A synthetic peptide for use as a blocking control in assays to test for specificity of Mrpl21 antibody, catalog no. 70R-8495

Nilutamide is an antineoplastic agent that is used to treat prostate cancer. This drug is an androgen receptor antagonist and binds with androgen receptors thus blocking its action and resulting in growth arrest. Nilutamide is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

1-Heptanoyl-2-hydroxy-sn-glycero-3-phosphocholine is a phospholipid compound that has been extensively studied in various experiments involving peroxisomes and human cells. It is known to enhance the activity of luciferases when used as a substrate in luciferase assays. Additionally, this compound has shown potential in promoting particle formation and increasing the expression of specific genes, such as those involved in salvianolic acid biosynthesis. Furthermore, 1-Heptanoyl-2-hydroxy-sn-glycero-3-phosphocholine has been found to have an impact on fructan metabolism and may play a role in regulating erythropoietin production. This versatile research chemical offers exciting possibilities for further exploration in various scientific fields.

Affinity purified Rabbit polyclonal Haptoglobin antibody

SLC5A10 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELVSEFSR^-OH include the following: Quantification of HER2 from gastroesophageal cancer (GEC) FFPE tissue by mass spectrometry (MS). TA Hembrough, L Henderson, B Rambo, WL Liao - 2014 - ascopubs.orghttps://ascopubs.org/doi/abs/10.1200/jco.2014.32.3_suppl.17 Application of selected reaction monitoring for multiplex quantification of clinically validated biomarkers in formalin-fixed, paraffin-embedded tumor tissue T Hembrough, S Thyparambil, WL Liao - The Journal of Molecular , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1525157813000561 The addition of FAIMS increases targeted proteomics sensitivity from FFPE tumor biopsies S Sweet , D Chain, W Yu, P Martin, M Rebelatto - Scientific Reports, 2022 - nature.comhttps://www.nature.com/articles/s41598-022-16358-1 High-Field Asymmetric Waveform Ion Mobility Spectrometry and Parallel Reaction Monitoring Increases Sensitivity for Clinical Biomarker Quantitation from Formalin S Sweet , D Chain, W Yu, P Martin, M Rebelatto - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.02.08.479554.abstract Precision of multiple reaction monitoring mass spectrometry analysis of formalin-fixed, paraffin-embedded tissue RW Sprung, MA Martinez, KL Carpenter - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr300130t High HER2 protein levels correlate with increased survival in breast cancer patients treated with anti-HER2 therapy P Nuciforo , S Thyparambil, C Aura , A Garrido-Castro - Molecular , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1574789115001611 Quantitative analysis of HER family proteins using mass spectrometry as a predictive tool of response to anti-HER therapies in breast cancer P Nuciforo - 2016 - ddd.uab.cathttps://ddd.uab.cat/record/169257 Quantitative measurement of HER2 expression to subclassify ERBB2 unamplified breast cancer M Moutafi , CJ Robbins , V Yaghoobi - Laboratory , 2022 - nature.comhttps://www.nature.com/articles/s41374-022-00804-9 How may targeted proteomics complement genomic data in breast cancer? M Guerin, A Gonacahttps://www.tandfonline.com/doi/abs/10.1080/14789450.2017.1256776 Mass-spectrometry-based quantitation of Her2 in gastroesophageal tumor tissue: comparison to IHC and FISH DVT Catenacci , WL Liao, L Zhao , E Whitcomb - Gastric Cancer, 2016 - Springerhttps://link.springer.com/article/10.1007/s10120-015-0566-0 Application of tissue mesodissection to molecular cancer diagnostics D Krizman, N Adey, R Parry - Journal of Clinical Pathology, 2015 - jcp.bmj.comhttps://jcp.bmj.com/content/68/2/166.short Species Contribution Reference Number CAG NAG, EGC IM, CAG GC - , Functional Mechanisms, and , 2023 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=prrjEAAAQBAJ&oi=fnd&pg=PA424&dq=(%22H-ELVSEFSR%5E-OH%22+OR+%22H-ELVSEFSR-OH%22+OR+%22ELVSEFSR%5E%22+OR+%22ELVSEFSR%22)+AND+peptide&ots=oR0eTtPIQb&sig=2JJuzsQTp_i07Ce7siYSGOkA4oc Species Contribution Reference Number CAG NAG, EGC IM, CAG GC - , Functional Mechanisms, and , 2023 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=prrjEAAAQBAJ&oi=fnd&pg=PA424&dq=(%22H-ELVSEFSR%5E-OH%22+OR+%22H-ELVSEFSR-OH%22+OR+%22ELVSEFSR%5E%22+OR+%22ELVSEFSR%22)+AND+peptide&ots=oR0eTtPIV9&sig=pTauq2lYj-QKQE1trDq14AwxcJo Isotopologue multipoint calibration for proteomics biomarker quantification in clinical practice C Chiva , O Pastor, L Trilla-Fuertes - Analytical , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.8b05802 A comparative study of gastric adenocarcinoma Her2 Ihc phenotype and mass spectrometry-based quantification B Xu, H Chen, J Zhang, Y Cong, L Ning, L Chen - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2023.1152895/full Companion and complementary diagnostics by mass spectrometry AR Blackler, MW Duncan - Companion and complementary diagnostics, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780128135396000092 Development of multiple reaction monitoring (MRM) assays to identify Brucella abortus proteins in the serum of humans and livestock AA Husain, SM Pinto , Y Subbannayya - PROTEOMICS , 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.202200009

A synthetic peptide for use as a blocking control in assays to test for specificity of ASPHD2 antibody, catalog no. 70R-3531

Mouse monoclonal NUPR1 antibody

1-188 amino acids: MASMTGGQQM GRGSHMQTIK CVVVGDGAVG KTCLLISYTT NKFPSEYVPT VFDNYAVTVM IGGEPYTLGL FDTAGQEDYD RLRPLSYPQT DVFLVCFSVV SPSSFENVKE KWVPEITHHC PKTPFLLVGT QIDLRDDPST IEKLAKNKQK PITPETAEKL ARDLKAVKYV ECSALTQKGL KNVFDEAILA ALEPPEPKKS RRC

Anti-Human TIGIT Monoclonal Antibody

This monoclonal Mouse anti-Cryptosporidium parvum has been shown to react with recombinant antigens and oocysts by ELISA, WB and Lateral flow.

Mouse monoclonal D-dimer antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PA2G4 antibody, catalog no. 70R-8718

A synthetic peptide for use as a blocking control in assays to test for specificity of AMFR antibody, catalog no. 70R-1149

IgA Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgA Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Applications 1-METHYLHYDANTOIN (cas# 616-04-6) is a useful research chemical.

Flavanomarein with HPLC

Na+ K+ ATPase alpha 1 antibody was raised in mouse using purified Na+/K+ ATPase isolated from membrane fractions of rabbit kidney outer medulla as the immunogen.

The PCNA antibody is a specific antibody used in Life Sciences research. It is commonly used in various applications such as immunohistochemistry, western blotting, and ELISA. This monoclonal antibody specifically targets proliferating cell nuclear antigen (PCNA), which is a marker for cell proliferation. PCNA plays a crucial role in DNA replication and repair processes. The PCNA antibody can be used to study cellular processes like cell cycle regulation, DNA synthesis, and repair mechanisms. It has been widely used in research related to collagen synthesis, adipose tissue development, amyloid plaque formation, alpha-fetoprotein expression, and growth factor signaling pathways. This high-quality antibody provides reliable and accurate results for researchers working with human serum samples or investigating autoantibodies. With its excellent specificity and sensitivity, the PCNA antibody is an essential tool for scientists studying various biological processes and diseases.

Rabbit polyclonal MP68 antibody (FITC)

Peptide H-VLDTSSLTQSAPASPTNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VLDTSSLTQSAPASPTNK-OH include the following: Mammalian target of rapamycin complex 1 (mTORC1) activity is associated with phosphorylation of raptor by mTOR L Wang, JC Lawrence, TW Sturgill, TE Harris - Journal of biological , 2009 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)82080-X/abstract

Cy5-SE is a fluorescent dye that can be used to stain proteins in the cytoplasm of living cells. This dye binds to the intracellular receptor, which has been labeled with Cy3 or Cy5 and is then excited by light at 532 nm. This dye is also used as a research tool and can be used to identify ligands that bind to a receptor and is useful for determining protein interactions. Cy5-SE has a high purity level, making it ideal for use in life science research. It can be used as an activator or inhibitor depending on the type of experiment being conducted.

Rabbit polyclonal Chk1 antibody (Ser301)

Applications Bis(4-hydroxyphenyl) Sulfone is commonly used as a reactant in epoxy reactions and is also used as a latent thermal catalyst for epoxy resin. References Fu, J.W., et al.: Adv. Mat. Rsch., 266, 1022 (2011); Li, J.X., et al.: Polymers. Adv. Tech., 23, 803 (2012);

Rabbit polyclonal RPL4 antibody

Rabbit polyclonal SENP7 antibody

AN3485 is a peptide inhibitor of the Protein kinase C (PKC) family. AN3485 binds to PKC with high affinity and inhibits its activity. This inhibition may be due to the competition for ATP binding by AN3485, which blocks the catalytic site of PKC. The high purity and low solubility of AN3485 make it suitable for use in research as a protein purification agent or in receptor binding studies.

C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP

H-ENLTNNAKTIIVQLN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ENLTNNAKTIIVQLN-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ENLTNNAKTIIVQLN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ENLTNNAKTIIVQLN-OH at the technical inquiry form on this page

Mouse monoclonal CRYZL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM67 antibody, catalog no. 70R-2772

Peptide H-AGGANSNVFSMFEQTQIQEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AGGANSNVFSMFEQTQIQEFK^-OH include the following: Smooth muscle myosin light chain kinase efficiently phosphorylates serine 15 of cardiac myosin regulatory light chain MP Josephson, LA Sikkink, AR Penheiter - Biochemical and , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X11020584 Quantitative phosphoproteomics analysis of actomyosin dissociation affected by specific site phosphorylation of myofibrillar protein L Cao, C Hou, Z Hussain , D Zhang, Z Wang - Lwt, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0023643820302577

Rabbit polyclonal CXCR3 antibody

TAPI-0 is a novel anti-inflammatory drug that binds to calmodulin and prevents the activation of protein kinase C. This compound inhibits many inflammatory mediators, including prostaglandin E2, cytokines and nitric oxide. Tapi-0 has been shown to be effective in decreasing the expression of chemokines such as MCP-1, MIP-1α, MIP-1β, RANTES and eotaxin in models of inflammation. TAPI-0 also inhibits the growth of cancerous cells by inhibiting transcriptional regulation. The mechanism by which TAPI-0 inhibits transcriptional regulation is not yet well understood but may involve inhibition of DNA polymerase activity.

Rabbit polyclonal LAT antibody

Rabbit polyclonal p70S6 Kinase antibody

FUBP3 antibody was raised in rabbit using the middle region of FUBP3 as the immunogen

GLYT1 antibody was raised in rabbit using a 20 amino acid peptide of rat GLYT1 as the immunogen.

Please enquire for more information about (±)13(14)-Epdpa including the price, delivery time and more detailed product information at the technical inquiry form on this page

Murashige and Skoog modified basal medium (with Kinetin)

Peptide H-ALQDQLVLVAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALQDQLVLVAAK-OH include the following: Proteomics approach for the discovery of rheumatoid arthritis biomarkers using mass spectrometry S Mun, J Lee, A Park, HJ Kim, YJ Lee, H Son - International journal of , 2019 - mdpi.comhttps://www.mdpi.com/1422-0067/20/18/4368 ASMS 2017 WP 055 S Mukherjee , S Walunj , P Sutar, A Datar, A Moiyadi - shimadzu.co.krhttps://www.shimadzu.co.kr/sites/shimadzu.co.kr/files/pim/pim_document_file/technical/white_papers/11486/apo21766.pdf A proteomic approach identifies candidate early biomarkers to predict severe dengue in children DM Nhi , NT Huy , K Ohyama, D Kimura - PLoS neglected , 2016 - journals.plos.orghttps://journals.plos.org/plosntds/article?id=10.1371/journal.pntd.0004435 A Quality Control of Proteomic Experiments Based on ABSGB Domon - proteomics, 2013 - cyberleninka.orghttps://cyberleninka.org/article/n/380724.pdf A quality control of proteomic experiments based on multiple isotopologous internal standards A Bourmaud, S Gallien, B Domon - EuPA open proteomics, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212968515300131 EuPA Open Proteomics A Bourmaud, S Gallien, B Domon - academia.eduhttps://www.academia.edu/download/85517372/82799133.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of MNAT1 antibody, catalog no. 20R-1192

Mouse monoclonal HIV2 gp105 antibody

Rabbit polyclonal TSPAN7 antibody

FASLG antibody was raised in rabbit using the middle region of FASLG as the immunogen

p-Methyl atomoxetine hydrochloride is a selective norepinephrine reuptake inhibitor, which is synthesized from chemical precursors typically through a series of organic reactions proceeding under controlled conditions. It functions by inhibiting the reuptake of norepinephrine in the synaptic cleft, resulting in increased concentrations of this neurotransmitter in the central nervous system. The primary utility of p-Methyl atomoxetine hydrochloride lies in its potential applications for addressing cognitive disorders and conditions characterized by deficits in attention and hyperactivity. By elevating norepinephrine levels, it may enhance attention, alertness, and overall cognitive function. These attributes make it a compound of interest in preclinical and clinical research contexts focused on neurological and psychiatric disorders. Further exploration into its pharmacokinetics and pharmacodynamics is essential for understanding its complete therapeutic profile and for the development of advanced therapeutic strategies.

CBX6 antibody was raised in rabbit using the N terminal of CBX6 as the immunogen

Mouse monoclonal Luteinizing Hormone beta antibody

RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS

Purified recombinant Rubella Virus Capsid C protein

Rabbit polyclonal SNRPD3 antibody

H-VSSLPSVTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VSSLPSVTLK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VSSLPSVTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VSSLPSVTLK-OH at the technical inquiry form on this page

Dopamine D2 receptor antagonist

Peptide H-EPFRDYVDRFYKTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EPFRDYVDRFYKTLR-OH include the following: Designing and engineering of DNA-vaccine construction encoding multiple CTL-epitopes of major HIV-1 antigens SI Bazhan, PA Belavin, SV Seregin, NK Danilyuk - Vaccine, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X04000908 Design of Artificial Immunogens Containing T-Cell Epitopes of Ebola Virus Proteins SI Bazhan, DV Antonets, LI Karpenko - Biotechnology in , 2018 - elibrary.ruhttps://elibrary.ru/item.asp?id=44565528 In silico designed ebola virus T-cell multi-epitope DNA vaccine constructions are immunogenic in mice SI Bazhan, DV Antonets, LI Karpenko, SF Oreshkova - Vaccines, 2019 - mdpi.comhttps://www.mdpi.com/2076-393X/7/2/34 In silico design of influenza a virus artificial epitope-based T-cell antigens and the evaluation of their immunogenicity in mice SI Bazhan, DV Antonets, EV Starostina - Journal of , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1845978 Approaches to Improve the Immunogenicity of Plasmid DNA-Based Vaccines against COVID-19 MB Borgoyakova, EA Volosnikova, AA Ilyichev - 2023 - intechopen.comhttps://www.intechopen.com/online-first/88789 Cross-clade immune responses to Gag p24 in patients infected with different HIV-1 subtypes and correlation with HLA class I and II alleles L Gudmundsdotter, D Bernasconi, B Hejdeman - Vaccine, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X08003496 Design of artificial immunogens containing melanoma-associated T-cell epitopes EA Borobova, DV Antonets, EV Starostina - Current Gene , 2018 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cgt/2018/00000018/00000006/art00006 DNA Vaccine Encoding the Artificial T-Cell Polyepitope Immunogen of Tick-Borne Encephalitis Virus DN Kisakov, DV Antonets, EV Shaburova - Bulletin of Experimental , 2023 - Springerhttps://link.springer.com/article/10.1007/s10517-023-05970-4 Artificial anti-HIV-1 immunogen comprising epitopes of broadly neutralizing antibodies 2F5, 10E8, and a peptide mimic of VRC01 discontinuous epitope AP Rudometov, AN Chikaev , NB Rudometova - Vaccines, 2019 - mdpi.comhttps://www.mdpi.com/2076-393X/7/3/83 Design and evaluation of optimized artificial HIV-1 poly-T cell-epitope immunogens A Reguzova, D Antonets, L Karpenko, A Ilyichev - PloS one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0116412

Purified native Human CRP protein

HIV1 integrase Monoclonal Antibody BSA/Azide Free

PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 20µg vial.

Mouse monoclonal MGLL antibody

The Leptin antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This antibody can be used to study the role of alpha-synuclein in disease progression and develop potential therapeutic interventions. Additionally, the Leptin antibody has been shown to have natriuretic effects, meaning it promotes the excretion of sodium through urine. This property makes it valuable in studying cardiovascular health and conditions related to fluid balance. Furthermore, this antibody has been used to target other proteins such as circumsporozoite protein (CSP), elastase protein, myostatin, lipoprotein lipase (LPL), glp-1, and fibrinogen. Its cytotoxic properties make it an effective tool for investigating cellular processes and developing targeted therapies. In summary, the Leptin antibody is a versatile tool in Life Sciences research due to

Mouse monoclonal NGAL antibody