Biochemicals and Reagents

Diacetylated Monoglycerides (USP grade powder) chemical reference substance

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Cellulose microcrystalline

Affinity purified Rabbit polyclonal UFD1L antibody

Please enquire for more information about Vitronectin antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE

FKN 39322 is a small molecule that binds to the G protein-coupled receptor (GPCR) and activates it. It has been shown to be an activator of the GPR37 receptor. FKN 39322 is a peptide with a molecular weight of 366.5 Da and a purity of >99%. This product can be used as an inhibitor in cell biology, as well as for research in life science and cell biology.

Purified recombinant CTSE protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4G antibody, catalog no. 70R-1918

Peptide H-FAVP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FAVP-OH include the following: Effect of amino acid substitutions on conformational stability of a protein K Yutani, K Ogasahara, Y Sugino - Advances in biophysics, 1985 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0065227X85900280

Rabbit anti-goat IgG (biotin) was raised in rabbit using goat IgG F(c) fragment as the immunogen.

Purified native Human Troponin C protein (Cardiac)

MYCN antibody was raised in mouse using recombinant Human V-Myc Myelocytomatosis Viral Related Oncogene, Neuroblastoma Derived (Avian)

Purified Rabbit polyclonal CD32 antibody (Tyr292)

Haptoglobin protein is a versatile molecule that plays an important role in various biological processes. It is a glycoprotein that binds to free hemoglobin, preventing its oxidative damage and facilitating its clearance from the bloodstream. This protein can be used as a reagent in various research applications, including immunoblotting, ELISA, and immunohistochemistry. Monoclonal antibodies specific to haptoglobin are available for use in these experiments. Additionally, haptoglobin has been shown to have neuroprotective effects and may play a role in modulating inflammation. Its acidic nature allows it to bind to other molecules such as insulin and fibronectin, further expanding its potential applications. Overall, haptoglobin is a valuable tool for researchers studying proteins and antigens and exploring their functions in different biological systems.

TAGLN 3 antibody was raised in rabbit using the N terminal of TAGLN 3 as the immunogen

NFKBIB antibody was raised in Mouse using a purified recombinant fragment of human NFKBIB expressed in E. coli as the immunogen.

Recombinant Human S100A11

Regorafenib is a multikinase inhibitor that inhibits the activity of kinases in the RAS-RAF-MEK-ERK pathway, which are enzymes that regulate cell proliferation. It is an oral drug used to treat patients with metastatic colorectal cancer who have been previously treated with chemotherapy. The target of regorafenib is the oncogenic kinases in the RAS-RAF-MEK-ERK pathway, which are important for tumor growth and progression. Regorafenib has shown efficacy against many different types of cancers, including colorectal, thyroid, lung and renal cancers.

L-azidovaline CHA salt

MK 8722 is an investigational small molecule agonist, derived from synthetic chemical compounds designed to target specific metabolic pathways. As an AMP-activated protein kinase (AMPK) activator, its mode of action involves the enhancement of cellular energy homeostasis by activating AMPK, which is a key regulator of cellular energy balance. This activation promotes the uptake and oxidation of glucose and fatty acids, mimicking the effects of physical exercise at the cellular level. The primary uses and applications of MK 8722 are being explored in various metabolic disorders, such as type 2 diabetes and obesity. By enhancing the activity of AMPK, MK 8722 may improve insulin sensitivity and promote weight loss, potentially offering a novel approach to managing these conditions. Current research is focused on understanding its efficacy and safety profile in clinical settings, as well as its potential to complement existing therapeutic strategies. Further studies will elucidate its role in metabolic disease management, with implications for broader applications in metabolic health.

Rabbit polyclonal SEK1 antibody

Goat anti-rabbit IgG (biotin) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A17 antibody, catalog no. 70R-6802

Androgen receptor antibody was raised in mouse using a synthetic peptide from human AR as the immunogen.

CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

Please enquire for more information about Affinity Purified anti-Cotton Rat IgG h+l Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Rabbit polyclonal PKA alpha antibody

Mouse monoclonal HSD17B10 antibody

H-TVLCPKNMIIKPGKI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TVLCPKNMIIKPGKI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TVLCPKNMIIKPGKI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TVLCPKNMIIKPGKI-OH at the technical inquiry form on this page

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal MAPK7 antibody

Rabbit polyclonal PEBP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT23 antibody, catalog no. 70R-2948

Mouse monoclonal GATA4 antibody

SARS-CoV-2 coronavirus spike glycoprotein S1 protein

Peptide H-SNICR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SNICR-OH include the following: Traitement du syndrome nephrotique idiopathique corticoresistant J Chemli, A Harbi - Archives de pediatrie, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0929693X08005976 Discovery of a new class of highly potent necroptosis inhibitors targeting the mixed lineage kinase domain-like protein B Yan, L Liu, S Huang, Y Ren, H Wang, Z Yao - Chemical , 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/cc/c7cc00667e

Rabbit polyclonal RPL38 antibody (biotin)

Purified recombinant Troponin I protein (cardiac)

hnRNP U/p120 Monoclonal Antibody

KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Mcl1-IN-2 is a recombinant human Mcl-1 inhibitor peptide. Mcl-1 is a proapoptotic protein that regulates cell death and survival signaling pathways. This recombinant peptide can be used as a research tool to study the regulation of apoptosis by Mcl-1. The peptide has been shown to inhibit the activation of caspases, which are enzymes that play an important role in the execution phase of apoptosis. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside br>Rifapentine is an anti-tuberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been shown

Affinity purified Rabbit polyclonal CHMP5 antibody

H-RNGFTVLCPKNMIIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RNGFTVLCPKNMIIK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RNGFTVLCPKNMIIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RNGFTVLCPKNMIIK-OH at the technical inquiry form on this page

Purified recombinant AAGAB protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of CAPN11 antibody, catalog no. 70R-9163

Purified Rabbit polyclonal MADS18 antibody

Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IWLDNVR^-OH include the following: Investigating blood and cerebrospinal fluid biomarkers in autosomal dominant Alzheimer's disease P Chatterjee - 2014 - research-repository.uwa.edu.auhttps://research-repository.uwa.edu.au/en/publications/investigating-blood-and-cerebrospinal-fluid-biomarkers-in-autosom

Sal-like4 (SALL4) derived peptide able to antagonise the SALL4-NuRD complex in hepatocellular carcinoma, turning SALL4 from a dual transcription repressor-activator to a singular transcription activator. Displays antitumour effects in xenograft mouse models.

H-CGGDSMYAPLLG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGDSMYAPLLG-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGDSMYAPLLG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGDSMYAPLLG-OH at the technical inquiry form on this page

H-NDMVNQMHEDVISLW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NDMVNQMHEDVISLW-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NDMVNQMHEDVISLW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NDMVNQMHEDVISLW-OH at the technical inquiry form on this page

Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALP^AP^IEK^-OH include the following: High-throughput LC-MS quantitation of cell culture metabolites Z Sun, Q Ji, AR Evans, MJ Lewis, J Mo, P Hu - Biologicals, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1045105619300788 Comparison of middle-and bottom-up mass spectrometry in forced degradation studies of bevacizumab and infliximab YFK Dyck, D Rehm, K Winkler, V Sandig, W Jabs - of pharmaceutical and , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708523003655 Qian Dong, qian. dong@ nist. gov, 3019752569 Y Liang, X Yan, SP Markey, YA Mirokhin - tsapps.nist.govhttps://tsapps.nist.gov/publication/get_pdf.cfm?pub_id=924777 PAWG pilot study on quantification of SARS-CoV-2 monoclonal antibody-part 1 W Mi, RD Josephs, JE Melanson , X Dai, Y Wang - Metrologia, 2022 - iopscience.iop.orghttps://iopscience.iop.org/article/10.1088/0026-1394/59/1A/08001/meta S1 Table. Complement to Fig 5: H10 antibody unique peptides detected by MS/MS in heavy chain fragment samples F1 to F6. VH EVQLVESGGGLVQPGGSLR - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/901d/a00f161ea9e078792d783f9e42e5efec2fb6.pdf Fast analysis of antibody-derived therapeutics by automated multidimensional liquid chromatography-mass spectrometry S Pot, C Gstöttner , K Heinrich, S Hoelterhoff - Analytica Chimica , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267021008412 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies authors S Millan-Martaca­n, C Jakes , G Oliviero , S Carillo - Thermo Fish , 2018 - lcms.labrulez.comhttps://lcms.labrulez.com/labrulez-bucket-strapi-h3hsga3/an_21835_lc_ms_peptide_mapping_ptm_mab_an21835_en_c972b7ab57/an-21835-lc-ms-peptide-mapping-ptm-mab-an21835-en.pdf Negligible In Vitro Recovery of Macromolecules from Microdialysis Using 100 kDa Probes and Dextran in Perfusion Fluid S Dorothee, G Sorensen, LR Olsen, JF Bastlund - Neurochemical , 2024 - Springerhttps://link.springer.com/article/10.1007/s11064-024-04119-7 The NISTmAb tryptic peptide spectral library for monoclonal antibody characterization Q Dong , Y Liang, X Yan, SP Markey, YA Mirokhin - MAbs, 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2018.1436921 The Analysis of Post-Translational Modifications in Protein Biotherapeutics Using Hilic-Ms P Collop - 2020 - search.proquest.comhttps://search.proquest.com/openview/ae80b158d0c6180b5f3a215034c6450b/1?pq-origsite=gscholar&cbl=18750&diss=y Development of immunocapture-LC/MS assay for simultaneous ADA isotyping and semiquantitation LZ Chen, D Roos , E Philip - Journal of Immunology Research, 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2016/7682472 Research Article Development of Immunocapture-LC/MS Assay for Simultaneous ADA Isotyping and Semiquantitation LZ Chen, D Roos , E Philip - 2016 - academia.eduhttps://www.academia.edu/download/85046571/pmc4806687.pdf Absolute quantification of the total and antidrug antibody-bound concentrations of recombinant human alpha-glucosidase in human plasma using protein G extraction and KJ Bronsema , R Bischoff , WWMP Pijnappel - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b00169 Investigating surrogate cerebrospinal fluid matrix compositions for use in quantitative LC-MS analysis of therapeutic antibodies in the cerebrospinal fluid JR Fogh, AM Jacobsen, TTTN Nguyen - Analytical and , 2020 - Springerhttps://link.springer.com/article/10.1007/s00216-020-02403-3 Investigation of the correlation between charge and glycosylation of IgG1 variants by liquid chromatography-mass spectrometry JM Yang, J Ai, Y Bao, Z Yuan, Y Qin, YW Xie, D Tao - Analytical , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269713005642 Solid-state mAbs and ADCs subjected to heat-stress stability conditions can be covalently modified with buffer and excipient molecules JF Valliere-Douglass , P Lewis, O Salas-Solano - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354915302264 Assessment of naturally occurring covalent and total dimer levels in human IgG1 and IgG2 J Yang, AM Goetze, GC Flynn - Molecular immunology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589013005610 A close look at human IgG sialylation and subclass distribution after lectin fractionation J Stadlmann , A Weber, M Pabst , H Anderle - , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200800931 Two-Dimensional Mass Spectrometry Analysis of IgG1 Antibodies J Paris , TE Morgan , BP Marzullo - Journal of the , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.1c00096 Anti-Abeta antibody aducanumab regulates the proteome of senile plaques and closely surrounding tissue in a transgenic mouse model of Alzheimer's disease J Bastrup , KH Hansen, TBG Poulsen - Journal of , 2021 - content.iospress.comhttps://content.iospress.com/articles/journal-of-alzheimers-disease/jad200715 Development of a highly sensitive liquid chromatography/tandem mass spectrometry method to quantify total and free levels of a target protein, interferon-gamma H Zhang, Q Xiao, B Xin, W Trigona - Rapid , 2014 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.6928 Forensic analysis of soman exposure using characteristic fragment ions from protein adducts F Fu, Y Guo, X Lu, P Zhao, S Zou - Human & , 2021 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/09603271211001111 Absolute and multiplex quantification of antibodies in serum using PSAQ™standards and LC-MS/MS D Lebert, G Picard, C Beau-Larvor, L Troncy - Bioanalysis, 2015 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.56 Affinity of IgE and IgG against cross-reactive carbohydrate determinants on plant and insect glycoproteins C Jin , B Hantusch , W Hemmer, J Stadlmann - Journal of Allergy and , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674907014480 A validated LC-MS/MS method for the quantification of bevacizumab in rat, cynomolgus monkey, and human serum A Zhou, J Yu, Y Wu, H Xue, D Zhong, X Diao - Journal of Pharmaceutical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S073170852300359X

Folinic acid calcium salt

Rabbit polyclonal RPA2 antibody (HRP)

Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPPSSGEPPK^-OH include the following: IP-LC-MSMS Enables Identification of Three Tau O-GlcNAcylation Sites as O-GlcNAcase Inhibition Pharmacodynamic Readout in Transgenic Mice Overexpressing S Bijttebier, D Rodrigues Martins - Journal of Proteome , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.2c00822 Cerebrospinal fluid phospho-tau T217 outperforms T181 as a biomarker for the differential diagnosis of Alzheimer's disease and PET amyloid-positive patient NR Barthelemy , RJ Bateman , C Hirtz , P Marin - Alzheimer's research & , 2020 - Springerhttps://link.springer.com/article/10.1186/s13195-020-00596-4

CCDC117 antibody was raised in rabbit using the middle region of CCDC117 as the immunogen

Rabbit polyclonal PTP1B antibody

H-SWLYLRTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SWLYLRTLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SWLYLRTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SWLYLRTLK-OH at the technical inquiry form on this page

GORASP2 antibody was raised in Rabbit using Human GORASP2 as the immunogen

Goat anti Rat IgG (H + L) secondary antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of NANOS1 antibody, catalog no. 70R-4987

Purified recombinant ARL4A protein

Peptide H-DLQNFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DLQNFLK-OH include the following: Myeloperoxidase-dependent lipid peroxidation promotes the oxidative modification of cytosolic proteins in phagocytic neutrophils RP Wilkie-Grantham, NJ Magon , DT Harwood - Journal of Biological , 2015 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)44448-5/abstract Analysis of the saliva proteome from patients with head and neck squamous cell carcinoma reveals differences in abundance levels of proteins associated with tumour P Dowling , R Wormald, P Meleady , M Henry - Journal of , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391908000663 Overexpression of calcium-binding protein calgranulin B in colonic mucosal diseases J Stulaca­k, H KovaÅ™ova, A Macela, J Bureš, P Jandaca­k - Clinica chimica acta, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898197001010 Proteomics investigation of OSCC-specific salivary biomarkers in a Hungarian population highlights the importance of identification of population-tailored biomarkers aca‰ CsÅ‘sz , P Labiscsak, G Kallo , B Markus , M Emri - PLoS , 2017 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0177282

D-Proline

Recombinant Human NRF2 protein (His tag)

GDI1 antibody was raised in Rabbit using Human GDI1 as the immunogen

Rabbit polyclonal MAEA antibody

The Influenza B Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody is designed to specifically target and bind to the Influenza B virus, preventing its replication and spread within the body. It has been extensively tested and validated for its high specificity and sensitivity in detecting and neutralizing the Influenza B virus. The Influenza B Antibody utilizes hybridization technology combined with streptavidin conjugation, allowing for easy and efficient detection of the virus in various biological samples. It can be used in a wide range of applications including research, diagnostics, and vaccine development. This antibody has also been shown to modulate immune responses by inhibiting the production of pro-inflammatory cytokines such as TNF-α and interferon. Additionally, it has been found to enhance the activity of growth factors and promote cell proliferation. The Influenza B Antibody is manufactured using state-of-the-art techniques and undergoes rigorous

Mouse sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

H-LIQDAVTGLTVNGQITGDK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LIQDAVTGLTVNGQITGDK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LIQDAVTGLTVNGQITGDK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LIQDAVTGLTVNGQITGDK-OH at the technical inquiry form on this page

Alpha 1 antitrypsin antibody was raised in rabbit using purified human serum Alpha-1-AT as the immunogen.

H-CSFWELIGEAAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CSFWELIGEAAK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CSFWELIGEAAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CSFWELIGEAAK-OH at the technical inquiry form on this page

Rabbit polyclonal GPR52 antibody

Mouse monoclonal IL21 antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of ATE1 antibody, catalog no. 70R-2256

H-IVQLNESVEINCTRP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IVQLNESVEINCTRP-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IVQLNESVEINCTRP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IVQLNESVEINCTRP-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf49 antibody, catalog no. 70R-4569

H-CLGQCASICVNDC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CLGQCASICVNDC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CLGQCASICVNDC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CLGQCASICVNDC-OH at the technical inquiry form on this page

Safit1 is a small molecule that has been shown to be effective in treating cancer. Safit1 inhibits the activity of glucocorticoid receptors, which are involved in the control of cellular response to stress and inflammation. It also inhibits the PD-L1 receptor, which is involved in cell proliferation and cancer resistance. Safit1 has been shown to have anti-inflammatory properties, as well as an ability to inhibit protein synthesis. Safit1 has also been shown to have a protective effect against metabolic disorders such as diabetes and obesity.

KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Peptide Ac-KKRYDREFLLGFQF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-KKRYDREFLLGFQF-NH2 include the following: Stabilizing the eIF4G1 alpha-helix increases its binding affinity with eIF4E: implications for peptidomimetic design strategies CJ Brown , JJ Lim, T Leonard, HCA Lim - Journal of molecular , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283610011757 Crystallization of eIF4E complexed with eIF4GI peptide and glycerol reveals distinct structural differences around the cap-binding site CJ Brown , CS Verma , MD Walkinshaw , DP Lane - Cell Cycle, 2009 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/cc.8.12.8742

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified recombinant HAND1 protein (His tag)

HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ

Rabbit polyclonal WDR45 antibody

Please enquire for more information about AE-848/32615073 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified native Human ApoA-II protein

H-MMQRGRKKRRQRRR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MMQRGRKKRRQRRR-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MMQRGRKKRRQRRR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MMQRGRKKRRQRRR-NH2 at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM2 antibody, catalog no. 70R-5571

Ac-KYWKGQHV-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-KYWKGQHV-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-KYWKGQHV-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-KYWKGQHV-NH2 at the technical inquiry form on this page

H-ESNICTTRGVNSCQQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ESNICTTRGVNSCQQ-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ESNICTTRGVNSCQQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ESNICTTRGVNSCQQ-OH at the technical inquiry form on this page

Mouse monoclonal Myc antibody

Please enquire for more information about MGAT2-IN-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal GM2A antibody

ELISA Kit for detection of NGFb in the research laboratory

H-IAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAA-OH at the technical inquiry form on this page

Goat anti-Mouse IgG2bFC - Affinity Purified

Rabbit polyclonal IRS1 antibody (Ser307)

Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal UBOX5 antibody

Purified Polyclonal Glycerol Kinase 2 antibody

Chymotrypsin antibody was raised in mouse using purified human pancreatic chymotrypsin as the immunogen.

Purified recombinant Clusterin protein

SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

A synthetic peptide for use as a blocking control in assays to test for specificity of TPD52L3 antibody, catalog no. 70R-3437

Rabbit polyclonal PAK4/5/6 antibody

ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Purified recombinant Human MAP2K3 protein

Rat monoclonal CD38 antibody (biotin)

SLC4A5 antibody was raised using the middle region of SLC4A5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL

Purified recombinant KIN17 protein

Purified Rabbit polyclonal ATP1 alpha antibody (Ser23)

Hydroxy-dPEG®24-t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®24-t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

2-Hydroxy-3,5-dichlorobenzenesulphonic acid, disodium salt

Mouse monoclonal NUDT6 antibody

This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.

Peptide H-VYYDPSKDLIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYYDPSKDLIA-OH include the following: A novel candidate HIV vaccine vector based on the replication deficient Capripoxvirus, Lumpy skin disease virus (LSDV) YJ Shen, E Shephard, N Douglass, N Johnston - Virology journal, 2011 - Springerhttps://link.springer.com/article/10.1186/1743-422X-8-265 An investigation into the Use of Lumpy Skin Disease Virus as a Vaccine Vector for a Potential HIV-1 vaccine YJ Shen - 2010 - open.uct.ac.zahttps://open.uct.ac.za/bitstreams/3613834b-88c7-4717-92c1-da05b1f25e9b/download RECOMBINANT LUMPY SKIN DISEASE VIRUS FOR PREVENTING AIDS WAL ZA, DN ZA, SYENJU ZA - sumobrain.orghttps://www.sumobrain.org/patents/wipo/Recombinant-lumpy-skin-disease-virus/WO2009101604A3.html Construction, characterization, and immunogenicity of a multigene modified vaccinia Ankara (MVA) vaccine based on HIV type 1 subtype C WA Burgers , E Shephard, JE Monroe - AIDS research and , 2008 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.2007.0205 Priming with Recombinant Auxotrophic BCG Expressing HIV-1 Gag R Chapman , H Stutz, W Jacobs Jr, E Shephard - RT and Gp120, 2013 - academia.eduhttps://www.academia.edu/download/46371321/Priming_with_Recombinant_Auxotrophic_BCG20160609-25391-xiiige.pdf Priming with recombinant auxotrophic BCG expressing HIV-1 Gag, RT and Gp120 and boosting with recombinant MVA induces a robust T cell response in mice R Chapman , H Stutz, W Jacobs Jr , E Shephard - PLoS , 2013 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0071601 The porcine circovirus type 1 capsid gene promoter improves antigen expression and immunogenicity in a HIV-1 plasmid vaccine FL Tanzer, EG Shephard, KE Palmer , M Burger - Virology journal, 2011 - Springerhttps://link.springer.com/article/10.1186/1743-422X-8-51 A multigene HIV type 1 subtype C modified vaccinia Ankara (MVA) vaccine efficiently boosts immune responses to a DNA vaccine in mice E Shephard, WA Burgers - AIDS research and , 2008 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.2007.0206

Peptide H-TPVITGAPYEYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPVITGAPYEYR-OH include the following: Integrated proteotranscriptomics of human myometrium in labor landscape reveals the increased molecular associated with inflammation under hypoxia stress L Chen, L Wang, Y Luo, Q Huang, K Ji, J Bao - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2021.722816/full

Influenza A antibody was raised in mouse using Influenza A as the immunogen.

Anti-viral; inhibits HIV entry in cells

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF9 antibody, catalog no. 70R-5603

Rabbit polyclonal OR51G2 antibody

The Prealbumin antibody is a powerful tool used in the field of Life Sciences to detect and study various proteins. This antibody specifically targets the prealbumin protein, which is involved in various biological processes such as growth factor signaling. It is commonly used in research studies to investigate the role of prealbumin in different cellular pathways. The Prealbumin antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific experimental needs. The polyclonal antibody is derived from multiple sources and recognizes different epitopes on the target protein, ensuring a high level of specificity and sensitivity. On the other hand, the monoclonal antibody is produced from a single clone of cells, offering consistent results across experiments. This antibody has been extensively validated for its performance and reliability. It exhibits strong reactivity towards human serum samples, making it an ideal tool for detecting prealbumin levels in clinical studies. Additionally, it shows excellent affinity towards glial fibrillary acidic protein (

H-LPLLNATIAEVLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPLLNATIAEVLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPLLNATIAEVLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPLLNATIAEVLR-OH at the technical inquiry form on this page

Rabbit polyclonal HMG20B antibody

NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP10 antibody, catalog no. 70R-5836