Biochemicals and Reagents

ADHFE1 antibody was raised in Rabbit using Human ADHFE1 as the immunogen

Please enquire for more information about Campylobacter antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Methyl (2S)-2-(2-chlorophenyl)-2-(9-thia-4-azabicyclo[4.3.0]nona-7,10-dien-4-yl)acetate, also know as Clopidogrel, is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.

CPT1A antibody was raised using a synthetic peptide corresponding to a region with amino acids  LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

EBV Capsid Antigen p18, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV Capsid Antigen p18, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

H-RHRYAEQENGINQGSAQMLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RHRYAEQENGINQGSAQMLS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RHRYAEQENGINQGSAQMLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RHRYAEQENGINQGSAQMLS-OH at the technical inquiry form on this page

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

CD44 antibody was raised in rat using murine CD44/Pgp-1 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ADRB1 antibody, catalog no. 70R-5939

Rabbit polyclonal APT1 antibody (HRP)

Mouse monoclonal MPL antibody

AGK antibody was raised in rabbit using the N terminal of AGK as the immunogen

Mca-Ala-Pro-Lys(Dnp)-OH trifluoroacetate salt is a high quality, versatile, and speciality chemical that is used as an intermediate in the synthesis of complex compounds. Mca-Ala-Pro-Lys(Dnp)-OH trifluoroacetate salt is also a useful scaffold for building block molecules and a versatile building block for peptide synthesis. This compound can be utilized in the manufacture of research chemicals and speciality chemicals.

H-DYSDTPPTSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DYSDTPPTSK-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DYSDTPPTSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DYSDTPPTSK-OH at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Affinity purified Rabbit polyclonal Liprin alpha 1 antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4F12 antibody, catalog no. 70R-7251

Mouse anti Human IgG1 antibody

Purified recombinant Human IL3 protein

MAGEA1 antibody was raised in Rabbit using Human MAGEA1 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

N-Carbamoyl-DL-aspartic acid, is a useful biochemical for proteomics research. It is also used as a carbamate derivative which serves as an intermediate in pyrimidine biosynthesis. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

S3QEL 2 is a compound that targets selective suppression of superoxide, a reactive oxygen species, exclusively from the mitochondrial respiratory complex I. It is categorized as a small-molecule inhibitor developed from biochemical research focused on mitochondrial function regulation. S3QEL 2 acts by specifically interacting with a site on the complex I that is responsible for superoxide production, thereby reducing oxidative stress within cells without interfering with the other normal functions of the electron transport chain. The use of S3QEL 2 primarily lies within the realm of scientific research. It serves as a valuable tool for scientists investigating the roles of mitochondrial superoxide in cellular processes including aging, metabolism, and the pathophysiology of various diseases such as neurodegenerative disorders and cancer. By modulating superoxide levels, S3QEL 2 assists in elucidating the oxidative mechanisms contributing to cellular damage and disease progression. This specificity aids researchers in discriminating the complex bioenergetic alterations and signaling pathways activated by oxidative stress, providing insights into potential therapeutic strategies that target mitochondrial dysfunction.

The cMyc antibody is a highly specialized antibody used in Life Sciences research. It specifically targets the cMyc protein, which plays a crucial role in cell growth and proliferation. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and flow cytometry. The cMyc antibody has been extensively studied and validated for its specificity and sensitivity. It has been shown to accurately detect the presence of cMyc protein in different sample types, such as tissue sections and cell lysates. Researchers rely on this antibody to study the expression levels of cMyc in various diseases, including cancer. In addition to its use in research, the cMyc antibody also has potential therapeutic applications. It can be used as an anti-cancer agent by targeting tumors that overexpress the cMyc protein. This makes it a promising candidate for targeted therapies against certain types of cancers. Overall, the cMyc antibody is a valuable tool for researchers and clinicians alike. Its

Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII

Mouse monoclonal NHEJ1 antibody

Affinity purified Rabbit polyclonal S100A11 antibody

Mouse sequence expressed in NS0 Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

H-CGGVDAYDRLSHGRKPQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGVDAYDRLSHGRKPQ-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGVDAYDRLSHGRKPQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGVDAYDRLSHGRKPQ-OH at the technical inquiry form on this page

Please enquire for more information about Thyroglobulin antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Homoglutathione H-Glu(Cys-b-Ala-OH)-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Cys-Ala-Thr-Lys-Val-Asn(NGA2F)-Phe-Thr-Glu-Ala-Gln-Lys-Ala-Ala-Leu-Asp-Val including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA5 antibody, catalog no. 70R-2092

Rabbit polyclonal Ubinuclein antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of FGD1 antibody, catalog no. 70R-7877

Rabbit polyclonal PYK2 antibody (Tyr580)

Rabbit polyclonal 14-3-3 zeta/theta antibody

Peptide H-YTAFTIPSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YTAFTIPSI-OH include the following: Structural and biochemical insights into the association between ERAP1 polymorphism and autoimmune diseases S Liu, J Lu, J Wu, D Feng, Y Wang, X Su - and Biophysical Research , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X22013420 Impaired function of circulating HIV-specific CD8+ T cells in chronic human immunodeficiency virus infection P Shankar, M Russo, B Harnisch - Blood, The Journal , 2000 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/96/9/3094/181209 Effective lysis of HIV-1-infected primary CD4+ T cells by a cytotoxic T-lymphocyte clone directed against a novel A2-restricted reverse-transcriptase epitope P Shankar, H Sprang, J Lieberman - JAIDS Journal of Acquired , 1998 - journals.lww.comhttps://journals.lww.com/jaids/abstract/1998/10010/Effective_Lysis_of_HIV_1_Infected_Primary_CD4__T.2.aspx Novel, in-natural-infection subdominant HIV-1 CD8+ T-cell epitopes revealed in human recipients of conserved-region T-cell vaccines N Borthwick , Z Lin, T Akahoshi, A Llano, S Silva-Arrieta - PloS one, 2017 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0176418 IRAP inhibitors: M1-aminopeptidase family inspiration N Barlow , PE Thompson - Frontiers in Pharmacology, 2020 - frontiersin.orghttps://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2020.585930/full Human immunodeficiency virus-specific circulating CD8 T lymphocytes have down-modulated CD3ζ and CD28, key signaling molecules for T-cell activation LA Trimble, P Shankar, M Patterson, JP Daily - Journal of , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.74.16.7320-7330.2000 A high-throughput MALDI-TOF MS biochemical screen for small molecule inhibitors of the antigen aminopeptidase ERAP1 L Muller, AK Burton, CL Tayler, JE Rowedder - SLAS Discovery, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S247255522213707X Targeting the regulatory site of ER aminopeptidase 1 leads to the discovery of a natural product modulator of antigen presentation J Liddle, JP Hutchinson, S Kitchen - Journal of Medicinal , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.9b02123 Antigen Load and Viral Sequence Diversification Determine the Functional Profile of HIV-1-Specific CD8+ T Cells H Streeck, ZL Brumme , M Anastario, KW Cohen - PLoS , 2008 - journals.plos.orghttps://journals.plos.org/plosmedicine/article?id=10.1371/journal.pmed.0050100 Loss of HIV-1-specific T-cell responses associated with very rapid HIV-1 disease progression H Streeck, B Schweighardt , H Jessen, RL Allgaier - Aids, 2007 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/2007/04230/Use_of_the_sensitive_less_sensitive__detuned__EIA.22.aspx Polymorphic positions 349 and 725 of the autoimmunity-protective allotype 10 of ER aminopeptidase 1 are key in determining its unique enzymatic properties G Georgaki, A Mpakali , M Trakada, A Papakyriakou - bioRxiv, 2024 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2024.03.14.584938.abstract Screening identifies thimerosal as a selective inhibitor of endoplasmic reticulum aminopeptidase 1 A Stamogiannos, A Papakyriakou - ACS Medicinal , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsmedchemlett.6b00084 Stabilization of the open conformation οf Insulin-Regulated Aminopeptidase by a novel substrate-selective small molecule inhibitor A Mpakali , G Georgaki, A Buson, AD Findlay, JS Foot - bioRxiv, 2024 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2024.06.04.597268.abstract

Purified Polyclonal BIM antibody

Peptide H-TVGVEPAADGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TVGVEPAADGK-OH include the following: Quantitative proteomic analysis of trachea in fatting pig exposed to ammonia H Wang, P Jiao, X Zhang, H Xing - Journal of Proteomics, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391921002293

Nup153 Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF708 antibody, catalog no. 70R-8962

Please enquire for more information about Pseudomonas aeruginosa serotype 6c Ab including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Mouse polyclonal HOXA6 antibody

Rabbit polyclonal ZHX1 antibody

Rat sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Peptide H-DTGILDSLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DTGILDSLGR^-OH include the following: Developmental validation of a multiplex proteomic assay for the identification of forensically relevant biological fluids HE McKiernan, PB Danielson , CO Brown - Forensic Science , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0379073821002280

Rabbit anti Goat IgG (H + L) secondary antibody

Custom research peptide; min purity 95%.

Purified Rabbit polyclonal HCK antibody (Tyr521)

Purified Recombinant TNF protein (His tagged)

Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide DOTA-GRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using DOTA-GRRRRRRRRRRR-OH include the following: Ubiquitin C-terminal hydrolase L1 (UCH-L1) promotes hippocampus-dependent memory via its deubiquitinating effect on TrkB YY Guo, Y Lu, Y Zheng, XR Chen, JL Dong - Journal of , 2017 - Soc Neurosciencehttps://www.jneurosci.org/content/37/25/5978.abstract Phosphorylation of cofilin regulates extinction of conditioned aversive memory via AMPAR trafficking Y Wang, Q Dong, XF Xu, X Feng, J Xin - Journal of , 2013 - Soc Neurosciencehttps://www.jneurosci.org/content/33/15/6423.short Programmed cell death 4 as an endogenous suppressor of BDNF translation is involved in stress-induced depression Y Li, Y Jia, D Wang, X Zhuang, Y Li, C Guo, H Chu - Molecular , 2021 - nature.comhttps://www.nature.com/articles/s41380-020-0692-x Blocking GSK3beta-mediated dynamin1 phosphorylation enhances BDNF-dependent TrkB endocytosis and the protective effects of BDNF in neuronal and mouse XH Liu, Z Geng, J Yan , T Li, Q Chen, QY Zhang - Neurobiology of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0969996114003660 Activation of a novel alpha2AAR-spinophilin-cofilin axis determines the effect of alpha2 adrenergic drugs on fear memory reconsolidation S Saggu , Y Chen, C Cottingham, H Rehman - Molecular , 2023 - nature.comhttps://www.nature.com/articles/s41380-022-01851-w LIM kinase 1 (LIMK1) interacts with tropomyosin-related kinase B (TrkB) and mediates brain-derived neurotrophic factor (BDNF)-induced axonal elongation Q Dong, YS Ji, C Cai, ZY Chen - Journal of Biological Chemistry, 2012 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)43820-7/abstract Carboxypeptidase E regulates activity-dependent TrkB neuronal surface insertion and hippocampal memory N Li, SW Teng, L Zhao, JR Li, JL Xu - Journal of , 2021 - Soc Neurosciencehttps://www.jneurosci.org/content/41/33/6987.abstract Blockage of GSK3beta-mediated Drp1 phosphorylation provides neuroprotection in neuronal and mouse models of Alzheimer's disease J Yan , XH Liu, MZ Han , YM Wang , XL Sun , N Yu - Neurobiology of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0197458014005181 Rac1 and Pak Activities Constrain Long-Term Auditory Fear Conditioning Memory Formation in Lateral Amygdala A Das - 2016 - search.proquest.comhttps://search.proquest.com/openview/c13e70e7831bf728c6ae97ed8f336851/1?pq-origsite=gscholar&cbl=2026366&diss=y

Azumolene is a Dantrolene analog that is a muscle relaxant. It binds to the ryanodine receptor and inhibits the release of calcium from the sarcoplasmic reticulum. This drug can be used for the research of malignant hyperthermia. Azumolene is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

A humanized monoclonal antibody directed against the immune receptor molecule KIR3DL2.

Rabbit polyclonal ADORA2B antibody

H-DSDGSFTLSLH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DSDGSFTLSLH-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DSDGSFTLSLH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DSDGSFTLSLH-OH at the technical inquiry form on this page

Purified recombinant Human UBL4A protein (His tag)

PEA15 antibody was raised in rabbit using the C terminal of PEA15 as the immunogen

FARS2 antibody was raised in Rabbit using Human FARS2 as the immunogen

1-154 amino acids: MGSSHHHHHH SSGLVPRGSH MPRRAENWDE AEVGAEEAGV EEYGPEEDGG EESGAEESGP EESGPEELGA EEEMEAGRPR PVLRSVNSRE PSQVIFCNRS PRVVLPVWLN FDGEPQPYPT LPPGTGRRIH SYRGHLWLFR DAGTHDGLLV NQTELFVPSL NVDGQPIFAN ITLP

HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG

Rabbit polyclonal FKBP1A antibody (FITC)

Mrpl21 antibody was raised in rabbit using the middle region of Mrpl21 as the immunogen

Rabbit Polyclonal NFkB p100/p52 antibody

Peptide Mal-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Mal-RTRPLWVRME-OH include the following: Maternal antibiotic treatment protects offspring from diabetes development in nonobese diabetic mice by generation of tolerogenic APCs Y Hu, J Peng, N Tai, C Hu, X Zhang - The Journal of , 2015 - journals.aai.orghttps://journals.aai.org/jimmunol/article/195/9/4176/105082 Absolute quantitation of tryptophan-containing peptides and amyloid beta-peptide fragments by coulometric mass spectrometry Y Ai , P Zhao , PIJ Fnu , H Chen - of the American Society for Mass , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.1c00121 Development of Novel Protein Digestion and Quantitation Methods for Mass Spectrometric Analysis Y Ai - 2023 - search.proquest.comhttps://search.proquest.com/openview/198379ce38281219995295aa8e5e346a/1?pq-origsite=gscholar&cbl=18750&diss=y IRAK-M deficiency promotes the development of T1DM in NOD mice Q Tan, M Majewska-Szczepanik, X Zhang - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=a3a79874e1c2edec9b81a90714a81019bc6d2937 Paradoxical dampening of anti-islet self-reactivity but promotion of diabetes by OX40 ligand N Martin-Orozco , Z Chen, L Poirot, E Hyatt - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/171/12/6954/72063 Th17 cells promote pancreatic inflammation but only induce diabetes efficiently in lymphopenic hosts after conversion into Th1 cells N Martin-Orozco , Y Chung , SH Chang - European journal of , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200838475 CD28/CD154 blockade prevents autoimmune diabetes by inducing nondeletional tolerance after effector t-cell inhibition and regulatory T-cell expansion MR Rigby, AM Trexler, TC Pearson, CP Larsen - Diabetes, 2008 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/57/10/2672/13402 MerTK regulates thymic selection of autoreactive T cells MA Wallet, RR Flores , Y Wang , Z Yi - Proceedings of the , 2009 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0900683106 MerTK is required for apoptotic cell-induced T cell tolerance MA Wallet, P Sen , RR Flores , Y Wang , Z Yi - The Journal of , 2008 - rupress.orghttps://rupress.org/jem/article-abstract/205/1/219/47074 Anti-CD3 treatment upregulates PD-1 expression on activated effector T cells and severely impairs their inflammatory capacity M Wallberg, A Recino, J Phillips, D Howie - , 2017 - cyberleninka.orghttps://cyberleninka.org/article/n/142793.pdf Modulating the T Cell Response: Using Anti-Interleukin-7 Receptor-Alpha Monoclonal Antibodies with Autoantigen-Specific Immunotherapy to Prevent Type-1 M Lawson - 2019 - search.proquest.comhttps://search.proquest.com/openview/188a09eacf39f7949c7a53f2ba0c1a01/1?pq-origsite=gscholar&cbl=18750&diss=y TLR5-deficiency controls dendritic cell subset development in an autoimmune diabetes-susceptible model JA Pearson, Y Hu, J Peng, FS Wong - Frontiers in Immunology, 2024 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2024.1333967/full Inhibition of the proteasome reduces transfer-induced diabetes in nonobese diabetic mice J Petrovic , H Hall, R Mehr , R Glas - Scandinavian journal of , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.0300-9475.2004.01473.x Increased diabetes development and decreased function of CD4+CD25+ Treg in the absence of a functional DAP12 adaptor protein HTL Hall, H Sjölin, H Brauner - European journal of , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200838259 TRIF deficiency protects non-obese diabetic mice from type 1 diabetes by modulating the gut microbiota and dendritic cells E Gulden, C Chao, N Tai, JA Pearson, J Peng - Journal of , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0896841118302580 Peripherally induced regulatory T cells contribute to the control of autoimmune diabetes in the NOD mouse model C Schuster, F Jonas, F Zhao - European journal of , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201847498 Dendritic cell-targeted pancreatic beta-cell antigen leads to conversion of self-reactive CD4+ T cells into regulatory T cells and promotes immunotolerance in C Petzold, J Riewaldt, T Koenig - The review of diabetic , 2010 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC2923380/ Foxp3+ Regulatory T Cells in Mouse Models of Type 1 Diabetes C Petzold, J Riewaldt, D Watts - Journal of diabetes , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2013/940710

Peptide H-VVGAVGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVGAVGVGK-OH include the following: The common neoantigens in colorectal cancer are predicted and validated to be presented or immunogenic Z Liang, L Qin, L Chen, W Li, C Chen, Y Huang - bioRxiv, 2019 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/682617.abstract Human T lymphocytes recognize a peptide of single point-mutated, oncogenic ras proteins. S Jung, HJ Schluesener - The Journal of experimental medicine, 1991 - rupress.orghttps://rupress.org/jem/article-abstract/173/1/273/24329 Abstract C004: TCRs directed to mutant KRAS display distinct antigen recognition motifs and minimal cross-reactivity to non-cognate antigens RB Nadler, A Bear , RH Vonderheide, GP Linette - Cancer Research, 2022 - AACRhttps://aacrjournals.org/cancerres/article/82/22_Supplement/C004/710393 Identification of T-cell receptors targeting KRAS-mutated human tumors QJ Wang, Z Yu, K Griffith, K Hanada, NP Restifo - Cancer immunology , 2016 - AACRhttps://aacrjournals.org/cancerimmunolres/article-abstract/4/3/204/468486 Identification and Validation of T-cell Receptors Targeting RAS Hotspot Mutations in Human Cancers for Use in Cell-based Immunotherapy N Levin , BC Paria, NR Vale, R Yossef , FJ Lowery - Clinical Cancer , 2021 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/27/18/5084/671639 Identification and affinity enhancement of T-cell receptor targeting a KRASG12V cancer neoantigen M Zhang, W Xu, L Luo, F Guan, X Wang, P Zhu - Communications , 2024 - nature.comhttps://www.nature.com/articles/s42003-024-06209-2 Characterization of the immunophenotypes and antigenomes of colorectal cancers reveals distinct tumor escape mechanisms and novel targets for immunotherapy M Angelova , P Charoentong , H Hackl , ML Fischer - Genome biology, 2015 - Springerhttps://link.springer.com/article/10.1186/s13059-015-0620-6 Hydrophobic interactions dominate the recognition of a KRAS G12V neoantigen KM Wright, SR DiNapoli, MS Miller - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-40821-w Systematic discovery of Neoepitope-HLA pairs for neoantigens shared among patients and tumor types HR Gurung , AJ Heidersbach, M Darwish - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41587-023-01945-y Facts and hopes in immunotherapy strategies targeting antigens derived from KRAS mutations GP Linette, AS Bear , BM Carreno - Clinical Cancer Research, 2024 - AACRhttps://aacrjournals.org/clincancerres/article/doi/10.1158/1078-0432.CCR-23-1212/733759 KRAS G12V neoantigen specific T cell receptor for adoptive T cell therapy against tumors D Lu, Y Chen, M Jiang, J Wang, Y Li, K Ma - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-42010-1 åŞºÀºŜÀœ“细ڃşçªå˜Ê•°Ê®åº“筛选å ç–«åŜŞÊ€§ç»“盎ڂ ç™Œé«˜é¢‘Ê–°ÊŠ—åŜŞçš„Ê–¹Ê³• çhttp://www.chinagene.cn/EN/Y2020/V42/I6/599 Generating optimal-affinity T cell receptors targeting the shared neoantigen KRAS G12V using the humanized TCR transgenic mouse platform HuTCR A Leliavski, L Knackstedt, J Oduro, C Selck - Cancer , 2022 - t-knife.comhttps://www.t-knife.com/file.cfm/47/docs/t-knife_aacr2022_poster_3052.pdf

AQP1 antibody was raised in Rabbit using Human AQP1 as the immunogen

GR 103691 is a neuroprotective drug that modulates the activity of the dopamine receptor. It has been shown to protect tubule cells from damage when they are exposed to toxic levels of dopamine in vitro. GR 103691 also protects animals against the symptoms of Parkinson’s disease. This drug inhibits 5-HT1A receptors, which may provide its neuroprotective effect. GR 103691 has also been found to have an inhibitory effect on renal proximal cells and locomotor activity in animals with nervous system diseases, as well as cancer cell culture.

Rabbit polyclonal TSN antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PUM2 antibody, catalog no. 70R-1467

Syrian Hamster monoclonal IgG Isotype Control antibody (PE)

H-SDLVNEEATGQFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SDLVNEEATGQFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SDLVNEEATGQFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SDLVNEEATGQFR-OH at the technical inquiry form on this page

L-azidophenylalanine CHA salt

Rabbit Polyclonal DHRS11 antibody

Catalogue peptide; min. 95% purity

Mouse Monoclonal HIV1 integrase Antibody; immunogen bacterially expressed, hexahistidine amino-terminal tagged HIV-1 integrase (IN) protein (clade B, HXB-3 isolate)

Bt Cry3B antibody was raised in rabbit using Bt Cry3B isolated from Bacillus thuringiensis as the immunogen.

Rabbit Polyclonal MARCKS antibody (Ser158)

Tnni3k antibody was raised in rabbit using the middle region of Tnni3k as the immunogen

ANGPTL7 antibody was raised in rabbit using the middle region of ANGPTL7 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TM7SF2 antibody, catalog no. 70R-6436

Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GTVNLTWSR^-OH include the following: Glycoproteomic studies of IgE from a novel hyper IgE syndrome linked to PGM3 mutation G Wu, PG Hitchen, M Panico, SJ North - Glycoconjugate , 2016 - Springerhttps://link.springer.com/article/10.1007/s10719-015-9638-y

1-87 amino acids: MGSSHHHHHH SSGLVPRGSH MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI

Rabbit polyclonal RAB2B antibody

Specific inhibitor of the phosphoinositide 3-kinase (PI3K) alpha subunit with IC50 of 32 nM. In heart muscle it negatively regulates hypertrophic growth, causes increase in late sodium current and leads to arrhythmias. In tumours it inhibits the p110α subunit of PI3K and blocks growth factor signalling resulting in reduced tumour growth.

PACSIN1 antibody was raised in rabbit using the C terminal of PACSIN1 as the immunogen

Peptide H-AVLGTSNFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVLGTSNFK-OH include the following: In silico spectral libraries by deep learning facilitate data-independent acquisition proteomics Y Yang , X Liu , C Shen , Y Lin , P Yang, L Qiao - Nature communications, 2020 - nature.comhttps://www.nature.com/articles/s41467-019-13866-z

Mouse monoclonal BECN1 antibody

Bis-PEG11-acid

Rabbit polyclonal ELMOD2 antibody

ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf44 antibody, catalog no. 70R-4163

AG2034 is a drug that is currently in development for the treatment of autoimmune diseases and prostate cancer. AG2034 has been shown to selectively inhibit the MAPK signal pathway at physiological levels, but not ATP levels. This drug also inhibits the cycle of DNA replication and transcription by binding to DNA gyrase, a type of enzyme that maintains the integrity of bacterial DNA. The drug has been shown to have no antimicrobial activity against bacteria, which may be due to its lack of antibiotic properties. AG2034 was synthesized using an asymmetric synthesis reaction with cell cultures and tissue culture techniques.

H-YVLFEVFDVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YVLFEVFDVV-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YVLFEVFDVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YVLFEVFDVV-OH at the technical inquiry form on this page

Peptide H-YIDDVVLGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YIDDVVLGA-OH include the following: High frequency of functional anti-YMDD and-mutant cytotoxic T lymphocytes after in vitro expansion correlates with successful response to lamivudine therapy for CL Lin, SL Tsai, TH Lee, RN Chien, SK Liao, YF Liaw - Gut, 2005 - gut.bmj.comhttps://gut.bmj.com/content/54/1/152.short Chronic diarrhoea after allogenic bone marrow transplantation B Radu, M Allez , JM Gornet, M Lemann, G Socie - Gut, 2005 - gut.bmj.comhttps://gut.bmj.com/content/54/1/161.extract

Mouse monoclonal ID3 antibody

Peptide H-GLSDGEWQQVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLSDGEWQQVL-OH include the following: Covalent labeling with isotopically encoded reagents for faster structural analysis of proteins by mass spectrometry Y Zhou , RW Vachet - Analytical chemistry, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac401978w Structural analysis of proteins by covalent labeling and mass spectrometric detection Y Zhou - 2014 - search.proquest.comhttps://search.proquest.com/openview/425c5abe09818bae2e9cac14112f057e/1?pq-origsite=gscholar&cbl=18750 Jong-Seo Kim, Jin-Su Song, Yongju Kim SB Park, HJ Kim - researchgate.nethttps://www.researchgate.net/profile/Seung-Bum-Park/publication/51895156_De_novo_analysis_of_protein_N-terminal_sequence_utilizing_MALDI_signal_enhancing_derivatization_with_Br_signature/links/54ec70a50cf2465f532f1443/De-novo-analysis-of-protein-N-terminal-sequence-utilizing-MALDI-signal-enhancing-derivatization-with-Br-signature.pdf De novo analysis of protein N-terminal sequence utilizing MALDI signal enhancing derivatization with Br signature JS Kim , JS Song, Y Kim, SB Park , HJ Kim - Analytical and bioanalytical , 2012 - Springerhttps://link.springer.com/article/10.1007/s00216-011-5642-7

C14orf129 antibody was raised in rabbit using the middle region of C14orf129 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf146 antibody, catalog no. 70R-3608

Rabbit polyclonal AP2M1 antibody (HRP)

Rat Beta 2-Microglobulin ELISA Kit Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.

Affinity purified Rabbit polyclonal PNPLA6 antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Lamin A+C Monoclonal Antibody (HRP)

Rabbit polyclonal SDCCAG3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ENOX1 antibody, catalog no. 70R-4808

Peptide H-YGGFLRRIRPKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YGGFLRRIRPKLKWDNQ-OH include the following: Nalpha selective acetylation of peptides T Mikami, T Takao , K Yanagi , H Nakazawa - Mass Spectrometry, 2012 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/massspectrometry/1/2/1_A0010/_article/-char/ja/ Molecular dynamics simulations of peptides and proteins with a continuum electrostatic model based on screened Coulomb potentials SA Hassan, EL Mehler, D Zhang - Structure, Function, and , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prot.10330 Suppression effects in enzymatic peptide ladder sequencing using ultraviolet-matrix assisted laser desorption/ionization-mass spectrometry R Kratzer, C Eckerskorn, M Karas - Electrophoresis, 1998 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/elps.1150191109 Effects of substitution of hydrophobic amino acids by tryptophan on receptor binding and biological activity of neuropeptide nociceptin K Okada, T Sujaku, R Nakashima - Bulletin of the , 1999 - academic.oup.comhttps://academic.oup.com/bcsj/article-abstract/72/8/1899/7351032 Direct detection of neuropeptide dynorphin A binding to the second extracellular loop of the κ opioid receptor using a soluble protein scaffold J Björneraca¥s, M Kurnik , M Oliveberg - The FEBS , 2014 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.12626 The use of dodecylphosphocholine micelles in solution NMR DA Kallick , MR Tessmer, CR Watts , CY Li - Journal of Magnetic Resonance , 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1064186685711466 Molecular modelling of the ORL1 receptor and its complex with nociceptin. CM Topham, L Mouledous , G Poda - Protein , 1998 - academic.oup.comhttps://academic.oup.com/peds/article-abstract/11/12/1163/1551871

PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids  FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

A synthetic peptide for use as a blocking control in assays to test for specificity of IRX6 antibody, catalog no. 20R-1145

Rat monoclonal MHC Class II antibody (allophycocyanin)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R2 antibody, catalog no. 70R-10305

ELISA kit for the detection of SSA in the research laboratory

H-LVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LVV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LVV-OH at the technical inquiry form on this page

Mnk1 is a protein that belongs to the family of MAP kinases. It is expressed in cardiac cells and may regulate transcription-polymerase chain reactions, translation, and virus-mediated gene expression. Mnk1 has been shown to interact with proteins involved in cancer and hepatitis. Mnk1 has also been shown to be a potential therapeutic target for meningioma and cancer.

Bis-dPEG®25-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®25-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.

A mouse IgG1 Anti-NCA-90 monoclonal antibody and a Fab fragment.

Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.

Cathelicidin-related anti-microbial peptide (CRAMP), is the mouse homologue of the human LL-37 antimicrobial peptide and shares 67% sequence identity with LL-37.CRAMP-18 is the anti-bacterial sequence derived from CRAMP, it possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP-18 also binds to lipopolysaccharide (LPS) to neutralise LPS activity.CRAMP is a cationic peptide, encoded for by the Camp gene and is highly expressed in bone marrow. Its expression is up-regulated by infectious and inflammatory signals and it is secreted by cells such as neutrophils, epithelial cells, and macrophages.

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC51 antibody, catalog no. 70R-3794

H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX7 antibody, catalog no. 70R-5097

Type I diabetes is an autoimmune condition caused by the destruction of insulin-producing β cells. The initiation mechanism is unclear but involves activating autoreactive T cells against the β-cell-specific antigen, insulin.RIP-B7.1 mice express CD80 on pancreatic β cells and are a model for studying de novo induction of diabetogenic CD8 T cells. Immunization of RIP-B7.1 mice with preproinsulin (ppins)-encoding plasmid DNA induces experimental autoimmune diabetes (EAD). EAD is associated with significant induction of CD8 T cells specific for the (A12-21) restricted epitope leading to the destruction of β cells.The Insulin A Chain (A12-21) epitope is recognised by pancreas-infiltrating CD8 T cells isolated from immunized, diabetic RIP-B7.1 mice as shown by flow cytometry. The Insulin A Chain (A12-21) epitope can also be used to stimulate inducible IFN- expression of ppins-primed CD8 T cells ex vivo as determined by flow cytometry. GFP fusion has shown the expression of insulin A chain (A12-21) epitope in HeLa cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD2 antibody, catalog no. 70R-3378

Sheep polyclonal Escitalopram antibody

Benzoylecgonine antibody was raised in mouse using benzoylecgonine-BSA as the immunogen.

Rabbit polyclonal Oncostatin M antibody (FITC)

IGF2BP1 antibody was raised using the N terminal of IGF2BP1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Mouse monoclonal AK3 antibody

N-(3-Bromophenyl)-1H-imidazo[4,5-G]quinazolin-8-amine, hydrochloride is a small molecule inhibitor, which is typically sourced from chemical synthesis performed under controlled laboratory conditions. This compound operates as a selective inhibitor targeting specific signaling pathways, such as those involving kinases that are often upregulated in cancerous cells. By interfering with these pathways, the compound can effectively disrupt cellular proliferation, making it a valuable tool for understanding cancer cell biology. Common uses and applications of N-(3-Bromophenyl)-1H-imidazo[4,5-G]quinazolin-8-amine, hydrochloride include serving as a probe in biochemical assays to dissect signaling mechanisms, particularly in the context of oncogenic processes. It is often employed in preclinical studies to evaluate its efficacy and potential as a therapeutic agent. Its role in research extends to aiding the development of new therapeutic strategies, as scientists investigate the pathways it affects and its potential effects on tumor growth and progression.

Rabbit polyclonal BSG antibody