Biochemicals and Reagents

Gly-Gly-Tyr-Arg acetate dihydrate is a tetrapeptide and a ligand for the enzyme papain. It binds to the active site of papain and inhibits its proteolytic activity. Gly-Gly-Tyr-Arg acetate dihydrate has been shown to be an inhibitor of trypsin and chymotrypsin, but not other proteases. It has also been shown to inhibit the polymerase chain reaction and RNA synthesis in vitro.

Peptide H-IESVLSSSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IESVLSSSGK-OH include the following: Sequential proteolysis and high-field FTICR MS to determine disulfide connectivity and 4-maleimide TEMPO spin-label location in L126C GM2 activator protein JD Tipton , JD Carter, JD Mathias, MR Emmett - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac9009935

A synthetic peptide for use as a blocking control in assays to test for specificity of SETD3 antibody, catalog no. 70R-9076

Please enquire for more information about C.I.Direct Yellow 147 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-YSAELHVAHWNSAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSAELHVAHWNSAK-OH include the following: Protein radical footprinting as a tool for protein therapeutcs validation. M Binar - 2018 - dspace.cuni.czhttps://dspace.cuni.cz/handle/20.500.11956/103469

A humanized IgG1 anti-EGFR antibody

Mycoplasma pneumonia protein is a recombinant protein that is commonly used in the field of life sciences. It is a monoclonal antibody that specifically targets the Mycoplasma pneumoniae bacteria, which is known to cause respiratory infections in humans. This protein can be activated and used for various applications, such as studying the role of Mycoplasma pneumoniae in disease development or testing the effectiveness of potential inhibitors or antibodies against this pathogen. Additionally, Mycoplasma pneumonia protein has been shown to have interactions with other molecules, including alpha-fetoprotein and adeno-associated virus, making it a valuable tool for researchers working in these areas. Its versatility and specificity make it an essential component in many studies related to infectious diseases and immunology.

Rabbit polyclonal Ovomucoid antibody (FITC)

TAAR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ITFG1 antibody, catalog no. 70R-6176

Collagen Type VI protein is a pegylated monoclonal antibody that belongs to the family of Proteins and Antigens. It is commonly used in Life Sciences for various research purposes. This protein has been shown to be activated by alpha-fetoprotein and acts as a kinase inhibitor. Collagen Type VI protein is native to the human body and plays a crucial role in maintaining the structural integrity of tissues. It interacts with phalloidin, which stabilizes actin filaments, providing support to cells. Additionally, this protein has been studied in multidrug resistance and its impact on creatine kinase levels in human serum. Its glycation properties make it a valuable tool for studying advanced glycation end products (AGEs) and their effects on cellular function.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT11 antibody, catalog no. 70R-9789

Rabbit polyclonal SSXT antibody

Integrin beta 1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the integrin beta 1 molecule, which plays a crucial role in cell adhesion and signaling. By blocking the function of integrin beta 1, this antibody can inhibit various cellular processes, including cell migration, proliferation, and differentiation. In addition to its role in cell adhesion, integrin beta 1 is also involved in important signaling pathways such as TGF-beta and epidermal growth factor (EGF) signaling. By blocking integrin beta 1, this antibody can modulate these pathways and potentially impact various cellular responses. Integrin beta 1 antibody is available in both polyclonal and monoclonal forms. Polyclonal antibodies are derived from multiple sources and recognize different epitopes on the target molecule, providing a broad range of coverage. Monoclonal antibodies, on the other hand, are derived from a single clone of cells and recognize a specific

Purified Bovine IgG (Fc) FITC conjugate

Sheep polyclonal 17b Boldenone antibody

Influenza A Virus Positive Human Nasopharyngeal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A Virus Positive Human Nasopharyngeal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-PGLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PGLYYF-OH include the following: Establishment of anti-C1q monoclonal antibodies to measure serum C1q levels discriminating disease severity subsets of rheumatoid arthritis within 5 years of onset C Yukioka, K Ebina, Y Shimaoka - Modern , 2020 - academic.oup.comhttps://academic.oup.com/mr/article-abstract/30/5/816/6301559

AZD9362 is a potent inhibitor of various human protein kinases that are involved in the regulation of tumor growth and apoptosis. It has been shown to have significant anticancer activity against a variety of cancer cell lines, including those derived from lung, breast, and colon tumors. AZD9362 works by inhibiting specific kinases that are involved in the cell cycle and promoting apoptosis in cancer cells. This medicinal compound is highly selective for its target kinases and has minimal off-target effects. AZD9362 can be detected in urine after administration, making it a useful tool for monitoring drug levels during clinical trials. It is considered to be a promising anticancer drug candidate due to its ability to selectively inhibit cancer cell growth while sparing normal cells.

ELISA kit for detection of TSP2 in the research laboratory

Peptide H-NNTRQSIRIGPGQTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NNTRQSIRIGPGQTF-OH include the following: The production, characterisation and application of monoclonal antibodies generated by immunisation with HIV-1C clade RGP140 envelope protein M Hassall, M Page, M Robinson, S Jeffs, I Jones - Journal of virological , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166093413003431

CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST

Rabbit polyclonal SmG antibody (biotin)

Ac-CELGSGLQVGA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CELGSGLQVGA-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CELGSGLQVGA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CELGSGLQVGA-NH2 at the technical inquiry form on this page

C18ORF10 antibody was raised using the middle region of C18Orf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NSLFEYQK^-OH include the following: The Edge Effect in High-Throughput Proteomics: A Cautionary Tale CB Maxwell, JK Sandhu, TH Cao - Journal of the , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.3c00035

1-152 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMSTP ARRRLMRDFK RLQEDPPVGV SGAPSENNIM QWNAVIFGPE GTPFEDGTFK LVIEFSEEYP NKPPTVRFLS KMFHPNVYAD GSICLDILQN RWSPTYDVSS ILTSIQSLLD EPNPNSPANS QAAQLYQENK REYEKRVSAI VEQSWNDS

PF 05214030 is a biosimilar monoclonal antibody, which is sourced from recombinant DNA technology and designed to inhibit tumor necrosis factor-alpha (TNF-α). This product functions by binding to TNF-α, a cytokine that plays a critical role in mediating inflammation. By preventing TNF-α from interacting with its receptors on cell surfaces, PF 05214030 effectively reduces the inflammatory response associated with various autoimmune and inflammatory conditions. The applications of PF 05214030 are primarily in the treatment of chronic inflammatory diseases such as rheumatoid arthritis, Crohn's disease, and psoriasis. The inhibition of TNF-α provides therapeutic benefits by alleviating symptoms and potentially slowing disease progression in these conditions. As a biosimilar, PF 05214030 offers a cost-effective option with similar efficacy and safety profiles as the original biologic reference product. This makes it a valuable tool in expanding access to biologic therapies for patients and healthcare systems worldwide.

A synthetic peptide for use as a blocking control in assays to test for specificity of TRNT1 antibody, catalog no. 70R-1345

H-KYPDGTITPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KYPDGTITPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KYPDGTITPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KYPDGTITPK-OH at the technical inquiry form on this page

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Amyloid-β (Aβ) is a globular protein of about 40 amino acids that is the major constituent of amyloid plaques. Aβ is derived from sequential proteolytic processing of amyloid precursor protein (APP) by enzymes called β-secretase and γ-secretase. The Aβ1-40 fragment has been implicated in Alzheimer's disease, and its production can be inhibited by antibodies. The fragment consists of 40 amino acids and contains a central region that shares sequence similarity with the immunoglobulin fold, flanked on either side by β-strands. The N terminus is hydrophobic while the C terminus is hydrophilic. It has been shown to form ion channels in lipid bilayers, which can be blocked by various ligands such as antibodies or peptides. CAS No.: 144409-99-4

Purified recombinant ompP2 protein (His tag)

AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK

The PPA1 antibody is a highly specialized antibody that targets the kinase receptor tyrosine phosphatase. It plays a crucial role in various biochemical processes, including the regulation of cell growth and differentiation. The PPA1 antibody has been extensively studied in the field of Life Sciences and has shown promising results as an antibody-drug conjugate. This polyclonal antibody specifically binds to the PPA1 antigen, which is expressed abundantly on tyrosine kinase receptors. By binding to these receptors, the PPA1 antibody can modulate their activity and signaling pathways, leading to potential therapeutic benefits. One notable application of the PPA1 antibody is its use in combination with doxorubicin, a widely used cytotoxic drug. Studies have shown that when doxorubicin is conjugated with the PPA1 antibody, it enhances its efficacy and reduces off-target toxicity. This targeted approach allows for more precise drug delivery and better treatment outcomes. In summary, the PPA1 antibody is

KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA

Mouse monoclonal UBXN10 antibody

Peptide 2Azido-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using 2Azido-WEAALAEALAEALAEHLAEALAEALEALAA-OH include the following: Bioinspired Design of Lysolytic Triterpenoid-Peptide Conjugates that Kill African Trypanosomes WM Leeder, F Giehler, J Joswig, HU Göringer - ChemBioChem, 2019 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201800674 GALA: a designed synthetic pH-responsive amphipathic peptide with applications in drug and gene delivery W Li, F Nicol, FC Szoka Jr - Advanced drug delivery reviews, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169409X03002801 Designer peptide delivery systems for gene therapy SP Loughran, CM McCrudden - European Journal of , 2015 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/ejnm-2014-0037/html Peptides as multifunctional players in cancer therapy SMP Vadevoo, S Gurung , HS Lee - & Molecular Medicine, 2023 - nature.comhttps://www.nature.com/articles/s12276-023-01016-x PEGylation of the GALA peptide enhances the lung-targeting activity of nanocarriers that contain encapsulated siRNA S Santiwarangkool, H Akita, T Nakatani - Journal of , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354917303465 Design of a new cell penetrating peptide for DNA, siRNA and mRNA delivery S Ali, C Dussouillez, B Padilla, B Frisch - The Journal of Gene , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jgm.3401 Smart polymersomes dually functionalized with cRGD and fusogenic GALA peptides enable specific and high-efficiency cytosolic delivery of apoptotic proteins P Yao, Y Zhang, H Meng, H Sun , Z Zhong - Biomacromolecules, 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biomac.8b01243 Endosome-disruptive peptides for improving cytosolic delivery of bioactive macromolecules I Nakase, S Kobayashi, S Futaki - Peptide Science, 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.21487 Biofunctional peptide-modified extracellular vesicles enable effective intracellular delivery via the induction of macropinocytosis I Nakase - Processes, 2021 - mdpi.comhttps://www.mdpi.com/2227-9717/9/2/224 A"Smart" 129Xe NMR Biosensor for pH-Dependent Cell Labeling BA Riggle , Y Wang , IJ Dmochowski - Journal of the American , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.5b01938

CRMP1 antibody was raised in Rabbit using Human CRMP1 as the immunogen

Recombinant human LAT protein (His tag)

This antibody reacts with heavy chains on human IgA (alpha chain) and.

ETP 45658 is a synthetic polymer composite, which is fabricated from a combination of organic monomers and inorganic fillers. This innovative material is produced through a controlled polymerization process that ensures a uniform distribution of fillers, enhancing its structural integrity. The polymer matrix acts as a reinforcing agent, providing enhanced thermal stability and mechanical strength. The primary mode of action involves the integration of the polymer chains with the filler particles, creating a network that significantly improves the material's durability and resistance to environmental stressors. ETP 45658 is commonly used in advanced engineering applications, such as aerospace components, where its lightweight nature and robust performance are critical. Additionally, its excellent resistance to thermal degradation makes it a preferred choice in high-temperature contexts. In the field of electronics, ETP 45658 serves as an effective insulating material, protecting circuits from thermal and electrical interference. Its versatility and adaptability to various industrial requirements make it a valuable addition to the material science repertoire.

H-TIVFNQSSGGDPEIV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TIVFNQSSGGDPEIV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TIVFNQSSGGDPEIV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TIVFNQSSGGDPEIV-OH at the technical inquiry form on this page

rac Enterolactone -13C3 is a stable isotope-labelled lignan, which is a type of compound derived from plant sources. It is biosynthesized through the conversion of dietary lignans by intestinal microbiota. The -13C3 label indicates that three carbon atoms in the compound have been replaced with the carbon-13 isotope, facilitating precise analytical tracking. This product acts as a tracer, allowing scientists to study metabolic pathways and the bioavailability of lignans in biological systems. The primary use of rac Enterolactone -13C3 is in metabolic and nutritional research, where it serves as a tool for investigating the role of lignans in human health. Researchers employ it in studies to understand its metabolism, distribution, and its potential impact on diseases like cancer and cardiovascular disorders. Additionally, rac Enterolactone -13C3 helps in elucidating the biological effects of plant-based diets, contributing to the broader field of nutrigenomics and personalized nutrition.

Rabbit Polyclonal CaMKII antibody (Thr286)

Neomycin sulphate

Rabbit polyclonal His tag antibody

Affinity purified Rabbit polyclonal Bax antibody

Carbonic anhydrase I antibody was raised in sheep using human carbonic anhydrase II purified from erythrocytes as the immunogen.

HSV6 37EA antibody was raised in mouse using 37 KDa early antigen of HHV6 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMD3 antibody, catalog no. 70R-9399

IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.

ELISA Kit for detection of IL27 in the research laboratory

Mouse monoclonal cRel antibody

Purified recombinant NDUFS2 protein (His tag)

CDK8-IN-2 is a potent and selective CDK inhibitor. The compound has been shown to inhibit the growth of leukemia cells in vitro, and has been shown to be active against cancer cells in vivo. CDK8-IN-2 was found to inhibit protein synthesis by blocking the phosphorylation of p27, a protein that regulates cell proliferation. CDK8-IN-2 also showed an anti-leukemic activity and could be a potential drug target for treating cancer. Studies have shown that CDK8-IN-2 is well tolerated with no toxic effects observed in laboratory mice or rats. CDK8-IN-2 was found to be safe and well tolerated in healthy human volunteers with no dose limiting toxicities observed at doses up to 150 mg/day.

Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. A carrier peptide that can be used to internalize fusion proteins This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Rabbit polyclonal OR51Q1 antibody

Rabbit polyclonal Pax5 antibody

SpUlp1 antibody was raised in rabbit using residues 7-20 of the SpUlp1 protein as the immunogen.

Peptide H-LSTIALALGVER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSTIALALGVER-OH include the following: DELL'ANEMIA DI DIAMOND-BLACKFAN M ARMIRAGLIO - med.unipmn.ithttps://www3.med.unipmn.it/Dottorato/Medicina_Molecolare/tesi-2009/Sessione_II/Tesi_Marta_Armiraglio.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of GDAP2 antibody, catalog no. 70R-3977

Anti-Human CA9 Monoclonal Antibody

CBS antibody was raised in Rabbit using Human CBS as the immunogen

Giardia lamblia Monoclonal Antibody

Rabbit polyclonal COL3A1 antibody (biotin)

Purified recombinant Human RCL protein

H-Ile-Ser-OH trifluoroacetic acid is a bioactive compound that has been cocrystallized with N,N′-dimethylformamide and analyzed using liquid chromatography/mass spectrometry. It has been shown to be hydrophilic and soluble in water. H-Ile-Ser-OH trifluoroacetic acid has also been detected by mass spectrometric methods as well as electrospray mass spectrometry.

Purified recombinant STEAP4 protein (His tag)

HSV1 antibody (biotin) was raised in goat using HSV type 1, strain F as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFD2 antibody, catalog no. 70R-2438

Rabbit polyclonal TDG antibody

Mouse monoclonal beta Catenin antibody

JNJ-54175446 is a novel antidepressant drug that has a high uptake in the brain. It is an investigational drug that has been shown to have a rapid onset of action and to be effective across multiple depression symptom domains, including mood, anxiety, and cognitive symptoms. JNJ-54175446 binds to the serotonin transporter (SERT) with higher affinity than other antidepressants, which may contribute to its rapid onset of action. The compound also penetrates the blood-brain barrier more easily than other antidepressants and does not show signs of tolerance or withdrawal when used for up to 12 weeks. Clinical studies have shown that JNJ-54175446 has pharmacokinetic properties suitable for once-daily administration. In addition, this drug has been shown to increase levels of brain-derived neurotrophic factor (BDNF) in rats and mice, as well as microglia cells in animal models. This suggests that JNJ-54175446 may have beneficial effects on the brain's microenvironment

Brofluthrinate is a kinase inhibitor that has shown potential as an anti-cancer agent. It has been found to inhibit the growth of human tumor and leukemia cells, including acute myeloid leukemia. Brofluthrinate works by inhibiting the activity of various kinases involved in cell proliferation, angiogenesis, and apoptosis. It also has antibacterial activity against certain strains of bacteria. In endothelial cells, brofluthrinate blocks phosphorylation and activation of proteins involved in angiogenesis, which may contribute to its anti-cancer effects. Overall, brofluthrinate is a promising compound for further investigation as a potential cancer treatment.

PARL antibody was raised in Mouse using a purified recombinant fragment of PARL(aa112-167) expressed in E. coli as the immunogen.

Catalogue peptide; min. 95% purity

WS3 is a heparin-like compound that has been shown to have potent anticoagulant activity and a broad spectrum of activity against bacteria, fungi, and parasites. WS3 is synthesized in the dark by light exposure. The molecular weight of WS3 is approximately 10 kilodaltons (kDa). It has been shown to induce epidermal growth factor production in mammalian cells. WS3 also exhibits high resistance to metabolic profiles, optical sensors, and light emission. This molecule has been shown to be efficient for the treatment of cutaneous lesions caused by fungal biomass.

GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Peptide H-AVAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVAANIVLTV-OH include the following: Islet-reactive CD8+ T cell frequencies in the pancreas, but not in blood, distinguish type 1 diabetic patients from healthy donors S Culina, AI Lalanne, G Afonso, K Cerosaletti - Science , 2018 - science.orghttps://www.science.org/doi/abs/10.1126/sciimmunol.aao4013

Please enquire for more information about AZD3264 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal PPP5C antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF185 antibody, catalog no. 70R-8290

RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Cellulose synthase is a crucial enzyme involved in the synthesis of cellulose. Cellulose is an aggregation of unbranched polymer chains made of β-(1-4)-linked glucose residues, and is a component of primary and secondary cell walls - functioning to primarily maintain strength and shape in cells. Cellulose is synthesised by large cellulose synthase complexes (CSCs), which consist of synthase protein isoforms (CesA) that are arranged into a unique hexagonal structure. Cellulose synthase 4 Light [Populus tomentosa] is specific to the Populus tomentosa species.

Purified Recombinant Prdx2 protein (His tagged)

Peptide H-SAINNYAQKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SAINNYAQKL-OH include the following: Inefficient cross-presentation limits the CD8+ T cell response to a subdominant tumor antigen epitope P Otahal, SC Hutchinson, LM Mylin - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/175/2/700/36672 Anti-CD40 conditioning enhances the TCD8 response to a highly tolerogenic epitope and subsequent immunotherapy of simian virus 40 T antigen-induced pancreatic P Otahal, BB Knowles , SS Tevethia - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/179/10/6686/75587 Rapid in vitro assembly of class I major histocompatibility complex NJ Papadopoulos, JC Sacchettini - Techniques in Protein , 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1080891406800463 Heat-shock protein 90 associates with N-terminal extended peptides and is required for direct and indirect antigen presentation MK Callahan , M Garg - Proceedings of the , 2008 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0711365105 Virus expanded regulatory T cells control disease severity in the Theiler's virus mouse model of MS MH Richards, MT Getts, JR Podojil , YH Jin , BS Kim - Journal of , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0896841110001484 TCR signal strength defines distinct mechanisms of T cell dysfunction and cancer evasion M Shakiba, P Zumbo , G Espinosa-Carrasco - Journal of Experimental , 2021 - rupress.orghttps://rupress.org/jem/article-abstract/219/2/e20201966/212936 Drivers of CD8 T Cell Dysfunction in Tumors M Shakiba - 2021 - search.proquest.comhttps://search.proquest.com/openview/c265768db80d44b3eccb0b18561ac3dd/1?pq-origsite=gscholar&cbl=18750&diss=y Hierarchy among multiple H-2b-restricted cytotoxic T-lymphocyte epitopes within simian virus 40 T antigen LM Mylin, RH Bonneau, JD Lippolis - Journal of virology, 1995 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.69.11.6665-6677.1995 Context-dependent immunogenicity of an S206G-substituted H-2Db-restricted simian virus 40 large T antigen epitope I variant LM Mylin - The Journal of Immunology, 1999 - journals.aai.orghttps://journals.aai.org/jimmunol/article/162/4/2171/43030 ERAP1-dependent antigen cross-presentation determines efficacy of adoptive T-cell therapy in mice K Schmidt, C Keller, AA Kuhl, A Textor, U Seifert - Cancer research, 2018 - AACRhttps://aacrjournals.org/cancerres/article-abstract/78/12/3243/625096 Rapid accumulation of adoptively transferred CD8+ T cells at the tumor site is associated with long-term control of SV40 T antigen-induced tumors JL Yorty, SS Tevethia, TD Schell - Cancer Immunology, Immunotherapy, 2008 - Springerhttps://link.springer.com/article/10.1007/s00262-007-0424-y Functional analysis of amino acid residues encompassing and surrounding two neighboring H-2Db-restricted cytotoxic T-lymphocyte epitopes in simian virus 40 tumor JD Lippolis , LM Mylin, DT Simmons - Journal of virology, 1995 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.69.5.3134-3146.1995 Antibody targeting tumor-derived soluble NKG2D ligand sMIC provides dual co-stimulation of CD8 T cells and enables sMIC+ tumors respond to PD1/PD-L1 J Zhang, PS Larrocha, B Zhang, D Wainwright - for immunotherapy of , 2019 - Springerhttps://link.springer.com/article/10.1186/s40425-019-0693-y Antibody-mediated neutralization of soluble MIC significantly enhances CTLA4 blockade therapy J Zhang, D Liu , G Li , KF Staveley-O'Carroll, JN Graff - Science , 2017 - science.orghttps://www.science.org/doi/abs/10.1126/sciadv.1602133 Goldilocks and the three TILs H Dada, ML Dustin - The Journal of Experimental Medicine, 2022 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8759607/ TOX is a critical regulator of tumour-specific T cell differentiation AC Scott , F Dundar , P Zumbo , SS Chandran - Nature, 2019 - nature.comhttps://www.nature.com/articles/s41586-019-1324-y

Mouse monoclonal Cardiotin antibody

H-LTRDGGNSTETETEIFRPGG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LTRDGGNSTETETEIFRPGG-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LTRDGGNSTETETEIFRPGG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LTRDGGNSTETETEIFRPGG-OH at the technical inquiry form on this page

4-Acetamidocyclohexyl) nitrate is an organic nitrate that is used as a vasodilator drug. It has been shown to be metabolized by the liver and excreted in the urine, with only a small amount being found in the feces. The elimination of 4-Acetamidocyclohexyl) nitrate is largely unchanged when healthy subjects are given it orally or intravenously. 4-Acetamidocyclohexyl) nitrate has a high bioavailability and low toxicity, making it a good choice for use in humans.

Estradiol Rabbit Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Estradiol Rabbit Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-TFTTQETITNAETAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TFTTQETITNAETAK-OH include the following: A high-resolution accurate mass multi-attribute method for critical quality attribute monitoring and new peak detection H Liu, R Quintyn, J Rontree - Thermo Fisher Scientific, 2019 - lcms.labrulez.comhttps://lcms.labrulez.com/labrulez-bucket-strapi-h3hsga3/an_72916_lc_ms_multi_attribute_method_cqa_mab_an72916_en_d67f57e7c5/an-72916-lc-ms-multi-attribute-method-cqa-mab-an72916-en.pdf

Amino-dPEG®4-(m-dPEG®8)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®8)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

(R)-9,10-Dihydro-beta-ergocryptine is a research tool that is also used as an activator or ligand. It binds to the receptor and cell biology. (R)-9,10-Dihydro-beta-ergocryptine can be used in the study of ion channels and high purity. This compound has been classified as a peptide and it interacts with proteins. It is available in CAS No. 88660-47-3 and is pharmacology and life science related.

The Aβ E22delta mutant (Osaka mutation) is more resistant to degradation by two major Aβ-degrading enzymes, neprilysin and insulin-degrading enzyme.  It also shows unusual aggregation properties with enhanced oligomerization but no fibrilization.

A synthetic peptide for use as a blocking control in assays to test for specificity of BASP1 antibody, catalog no. 70R-9935

Purified recombinant KCNMB3 protein (His tag)

Penicillin antibody was raised in mouse using penicillin-BSA as the immunogen.

Peptide H-IPAMVVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IPAMVVDR-OH include the following: LC-MS/MS multiplexed assay for the quantitation of a therapeutic protein BMS-986089 and the target protein Myostatin Y Zhu, C D'Arienzo, Z Lou, A Kozhich, M Madireddi - Bioanalysis, 2016 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.238 A multiplexed immunocapture liquid chromatography tandem mass spectrometry assay for the simultaneous measurement of myostatin and GDF-11 in rat serum using Y Zhao, G Liu, FC Zambito, YJ Zhang, BS DeSilva - Analytica chimica , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267017305007 ORAL O11 HEADACHE WITH ANALYSIS OF NSAIDS IN FOODS OF ANIMAL ORIGIN P Jedziniak , K Pietruk - RESIDUES OF VETERINARY DRUGS IN FOOD, 2022 - vliz.behttps://www.vliz.be/imisdocs/publications/390419.pdf#page=66 Age trends in growth and differentiation factor-11 and myostatin levels in healthy men, and differential response to testosterone, measured using liquid L Peng, T Gagliano-Juca , KM Pencina - The Journals of , 2022 - academic.oup.comhttps://academic.oup.com/biomedgerontology/article-abstract/77/4/763/6284042 Targeted approach to distinguish and determine absolute levels of GDF8 and GDF11 in mouse serum L Camparini, L Kollipara , G Sinagra, FS Loffredo - , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201900104 Dystrophin-deficient dogs with reduced myostatin have unequal muscle growth and greater joint contractures JN Kornegay , DJ Bogan, JR Bogan, JL Dow, J Wang - Skeletal muscle, 2016 - Springerhttps://link.springer.com/article/10.1186/s13395-016-0085-7 Quantitative measurements of GDF-8 using immunoaffinity LC-MS/MS J Palandra, A Quazi, L Fitz , H Rong - PROTEOMICS , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201500112 A sensitive antibody-free 2D-LC-MS/MS assay for the quantitation of myostatin in the serum of different species G Zhang, S Chen, K Song, P Pan, Y Qiu , L Amaravadi - Bioanalysis, 2019 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2018-0311

Rabbit polyclonal RORC antibody

ELISA Kit for detection of IL12 (p70) in the research laboratory

H-KRTLRRKRTLRRKRTLRR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRTLRRKRTLRRKRTLRR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRTLRRKRTLRRKRTLRR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRTLRRKRTLRRKRTLRR-OH at the technical inquiry form on this page

CAMSAP1L1 antibody was raised in Rabbit using Human CAMSAP1L1 as the immunogen

FGFR4 Monoclonal Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF670 antibody, catalog no. 70R-8103

Please enquire for more information about 1-Azido-4-hydroxy-2-butanone including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal CD41a antibody

Human sequence expressed in HEK-293 Cells; purity >90% by SDS PAGE.

H-DEVSASLAKQGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DEVSASLAKQGL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DEVSASLAKQGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DEVSASLAKQGL-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA1L antibody, catalog no. 70R-4431

Please enquire for more information about N,N-Bis[2-(phenylthio)phenyl]urea including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal SAT1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PIBF1 antibody, catalog no. 70R-9148

Rat monoclonal Galectin 3 antibody

H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 is a tetrameric peptide that has been shown to have a broad spectrum of biological activity. This peptide may be involved in the regulation of cell growth and proliferation, which may contribute to its anti-inflammatory effects. H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 also inhibits the production of nitric oxide, which may contribute to its antimicrobial properties against bacteria and fungi.

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINC1 antibody, catalog no. 70R-5363

KRT36 antibody was raised in Rabbit using Human KRT36 as the immunogen

MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKKGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA

Peptide Ac-LLM-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-LLM-CHO include the following: Cost-Effective Online Multi-LLM Selection with Versatile Reward Models X Dai , J Li, X Liu, A Yu, J Lui - arXiv preprint arXiv:2405.16587, 2024 - arxiv.orghttps://arxiv.org/abs/2405.16587 Subtle differences in initial membrane interactions underpin the selectivity of small antimicrobial peptides S Praporski, A Mechler , F Separovic - ChemPlusChem, 2015 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cplu.201402318 Bioinfo-Bench: A Simple Benchmark Framework for LLM Bioinformatics Skills Evaluation Q Chen, C Deng - bioRxiv, 2023 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2023.10.18.563023.abstract Protein kinase C-ÎŽ isoform mediates lysosome labilization in DNA damage-induced apoptosis N Parent, M Scherer, G Liebisch - International , 2011 - spandidos-publications.comhttps://www.spandidos-publications.com/ijo/38/2/313 Can large language models predict antimicrobial peptide activity and toxicity? M Orsi , JL Reymond - RSC Medicinal Chemistry, 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/md/d4md00159a Computer-aided design of beta-sheet peptides M Lopez , E Lacroix, M Ramı́rez-Alvarado - Journal of molecular , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283601949186 ProLLM: Protein Chain-of-Thoughts Enhanced LLM for Protein-Protein Interaction Prediction M Jin, X Haochen , Z Wang , B Kang, R Ye, K Zhou - bioRxiv, 2024 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2024.04.18.590025.abstract Lactacystin, an inhibitor of the proteasome, blocks the degradation of a mutant precursor of glycosylphosphatidylinositol-linked protein in a pre-Golgi compartment K Oda, Y Ikehara, S Omura - Biochemical and biophysical research , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X96903149 Tx-LLM: A Large Language Model for Therapeutics JMZ Chaves, E Wang, T Tu , ED Vaishnav - arXiv preprint arXiv , 2024 - arxiv.orghttps://arxiv.org/abs/2406.06316 Intact proteins can bind to class II histocompatibility molecules with high affinity HA Runnels, DA Weber, JC Moore, LE Westerman - Molecular , 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589097000436 Membrane mediated antimicrobial and antitumor activity of cathelicidin 6: Structural insights from molecular dynamics simulation on multi-microsecond scale BR Sahoo , T Fujiwara - PLoS One, 2016 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0158702 Inhibition of the chymotrypsin-like activity of the pituitary multicatalytic proteinase complex A Vinitsky , C Michaud, JC Powers , M Orlowski - Biochemistry, 1992 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/bi00154a014 Peptide folding and aggregation studied using a simplified atomic model A Irback - Journal of Physics: Condensed Matter, 2005 - iopscience.iop.orghttps://iopscience.iop.org/article/10.1088/0953-8984/17/18/012/meta