Biochemicals and Reagents

Catalogue peptide; min. 95% purity

GSK143 is a peptide that activates an antibody and receptor to induce cell death. It has been shown to be a potent inhibitor of ion channels, including calcium channels and potassium channels. GSK143 also interacts with a variety of proteins in the cell, such as ligands and receptors, which may be used to study receptor-ligand interactions. GSK143 is soluble in water and has a purity of > 99% (HPLC).

Staurosporine is a fluorogenic substrate for the enzyme staurosporinase that is used in food testing, environmental testing, and diagnostics. It can be conjugated to an antibody or other protein to produce a ligand that binds to a receptor on the cell surface. Staurosporine has been shown to inhibit the activity of various enzymes including phospholipase A2, phospholipase C, and protein kinase C. It also inhibits bacterial DNA gyrase and topoisomerase IV. The fluorescence of staurosporine can be detected with luminometers or fluorescent microscopes.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM173 antibody, catalog no. 70R-2359

A synthetic peptide for use as a blocking control in assays to test for specificity of APPL1 antibody, catalog no. 70R-2700

A synthetic peptide for use as a blocking control in assays to test for specificity of COPB1 antibody, catalog no. 70R-2204

Peptide H-VFSLQWGEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VFSLQWGEVK-OH include the following: Clinically applicable deep learning algorithm using quantitative proteomic data H Kim , Y Kim , B Han , JY Jang - Journal of proteome , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.9b00268

25OH Vitamin D Assay Buffer Screening Kit - 10 Solutions

Peptide H-AGEVQEPELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AGEVQEPELR-OH include the following: A candidate panel of eight urinary proteins shows potential of early diagnosis and risk assessment for diabetic kidney disease in type 1 diabetes J Altman , S Bai, S Purohit , J White, D Steed, S Liu - Journal of , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S187439192400099X Discovery and longitudinal evaluation of candidate protein biomarkers for disease recurrence in prostate cancer CL Tonry, D Doherty, C O'Shea - Journal of proteome , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.5b00041

Please enquire for more information about Cyproheptadine-10,11-epoxide including the price, delivery time and more detailed product information at the technical inquiry form on this page

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Rabbit polyclonal ADAM17 antibody

PRDM6 antibody was raised in rabbit using the N terminal of PRDM6 as the immunogen

Rabbit polyclonal TADA3L antibody

TSH antibody (HRP) was raised in mouse using human TSH beta as the immunogen.

Peptide H-SDGPVK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SDGPVK^V-OH include the following: An endogenous peptide marker differentiates SOD1 stability and facilitates pharmacodynamic monitoring in SOD1 amyotrophic lateral sclerosis I Gertsman, J Wuu, M McAlonis-Downes - JCI insight, 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6542602/ Protein kinetics of superoxide dismutase-1 in familial and sporadic amyotrophic lateral sclerosis CV Ly, MD Ireland, WK Self , J Bollinger - Annals of Clinical , 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/acn3.51784

Please enquire for more information about TSH antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Bromo-PEG2-bromide

A synthetic peptide for use as a blocking control in assays to test for specificity of BEST3 antibody, catalog no. 70R-5135

Rabbit polyclonal CKMT antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of PWP2 antibody, catalog no. 70R-1968

DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD

Zataroside B is a novel marine-derived compound, which is a potent cytotoxic agent sourced primarily from marine sponge extracts. Its mode of action involves the disruption of microtubule dynamics, leading to the inhibition of mitotic spindle formation and ultimately inducing apoptosis in cancer cells. The specificity of Zataroside B towards disrupting cancer cell proliferation while sparing healthy cells makes it a promising candidate for anti-cancer therapy research. Studies investigating Zataroside B focus on its application in the treatment of various aggressive cancers, including metastatic and drug-resistant forms. Due to its unique mechanism and marine origin, it represents a new frontier in natural product pharmacology with potential implications in developing targeted therapies.

Region of MIP1 beta protein corresponding to amino acids APMGSDPPTS CCFSYTSRQL HRSFVMDYYE TSSLCSKPAV VFLTKRGRQI CANPSEPWVT EYMSDLELN.

2,4-Difluoro-3-phenoxyphenyl)methanamine is a high purity, cell biology research tool that can be used in pharmacology. It is an inhibitor of the ion channel and activator of the receptor. The antibody interacts with protein and has been shown to inhibit ligand binding to the receptor. This chemical compound has CAS number 1401839-25-5.

Mouse monoclonal C21orf59 antibody

m-PEG12-amine

GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

PGP9.5 antibody was raised in mouse using recombinant human PGP9.5 (1-223aa) purified from E. coli as the immunogen.

Rat monoclonal CD5 antibody (FITC)

Stanniocalcin-1 is a protein that belongs to the stanniocalcin family of proteins. It is expressed by a variety of tissues and has been shown to have chemotactic, pleiotropic, and adipogenic effects. Stanniocalcin-1 also regulates luteinization and homologous differentiation in cells. The recombinant form of this protein has been shown to stimulate the growth of cells in culture with high levels of expression. Additives such as deionized water and chromatographic techniques can be used to purify this protein.

Please enquire for more information about t-TUCB including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal ALK antibody (Tyr1096)

Glutaraldehyde-stabilized freshly prepared Mouse Red Blood Cells

A synthetic peptide for use as a blocking control in assays to test for specificity of STX4 antibody, catalog no. 70R-9806

Purified recombinant UBE2D1 protein

human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized

PIGA antibody was raised in rabbit using the middle region of PIGA as the immunogen

Human IgE antibody was raised in goat using purified human IgE as the immunogen.

Ac-RFAAAAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RFAAAAA-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RFAAAAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RFAAAAA-OH at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Dengue antibody (Complex) was raised in mouse using dengue type 4 as the immunogen.

Rabbit polyclonal ID4 antibody

H-IEICGHKAIGTVLVG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IEICGHKAIGTVLVG-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IEICGHKAIGTVLVG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IEICGHKAIGTVLVG-OH at the technical inquiry form on this page

Clozapine N-oxide hydrochloride is a high purity, pharmacologically active compound that is used as a research tool. It binds to the receptor and activates it by binding to the ligand-binding site. Clozapine N-oxide hydrochloride has been shown to inhibit ion channels and activate peptides such as caspase-3, which are involved in cell death. Clozapine N-oxide hydrochloride also inhibits the production of nitric oxide, an important factor in inflammation.

A synthetic peptide for use as a blocking control in assays to test for specificity of ARL8B antibody, catalog no. 70R-3527

Purified Polyclonal AKAP5 antibody

Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ADDGRPFPQVIK^-OH include the following: Multiple reaction monitoring-based targeted assays for the validation of protein biomarkers in brain tumors S Ghantasala , MGJ Pai , D Biswas , N Gahoi - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2021.548243/full Enhanced sensitivity in proteomics experiments using FAIMS coupled with a hybrid linear ion trap/Orbitrap mass spectrometer J Saba, E Bonneil, C Pomies, K Eng - Journal of proteome , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr801106a Protein mapping by combined 2-D electrophoresis and mass spectrometry: an approach to identify the proteome changes in muscle of diabetic rats and treatment with D Karthik, S Ravikumar - Journal of Experimental & , 2012 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=13094572&AN=84432440&h=N737vWj75Zf7ubXanextjZR7Xk0V5gu7Y1aRR2FfJGUuC2b9fvonTpRhRy7pfZzxw6RULQ9CLl8%2BZTW%2BRS6ZrA%3D%3D&crl=c Anticancer peptides from induced tumor-suppressing cells for inhibiting osteosarcoma cells CP Cui , QJ Huo, X Xiong , KX Li, P Ma - American Journal of , 2023 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC10560922/

Neuropeptide: Neuropeptides are small signaling molecules produced and released by neurons engaged in many physiological functions. Indeed, neuropeptides act on neural substrates such as G protein-coupled receptors (GPCRs), tyrosine-kinase receptor, insuline-like peptides and also ion channels. Actions of neuropeptides result in slow-onset, long-lasting modulation of synaptic transmission. Neuropeptide NPSF (SQAFLFQPQRF-NH2): Neuropeptide NPSF (SQAFLFQPQRF-NH2) is part of the FMRFamide-related peptides family. Neuropeptide NPSF has shown an important role in pain regulation and plays a role of anti-opiate. Moreover, Neuropeptide NPSF seems to be implicate in variety of physiological processes such as food intake, insulin release, blood pressure regulation and electrolyte balance. Neuropeptide NPSF (SQAFLFQPQRF-NH2) is useful in opioid research.

Biotin-PEG2-Claudin-3 is derived from the tight junction protein Claudin-3 which is encoded by the CLDN3 gene located on chromosome 7q11.23 and can be found within epithelial cell to cell contacts. Structurally, the Claudin family are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.During cancer research reduction in the number of Claudins has been associated with tumour formation. This could be explained using Claudin role in maintaining cell detachment and migration although cancers such as breast and prostate have shown to overexpress both Claudin- 3 and Claudin-4. Similarly in ovarian cancer overexpression of Claudin 3 and 4 is thought to increase the motility of tumour cells and their survival through basement membrane degrading matrix metalloproteinase activation.Both Claudin 3 and 4 have potential to be used as diagnostic markers and their two extracellular loops may be used as targets for antibodies. As receptors for the Clostridium perfringens enterotoxin, Claudin 3 and 4 may have further use in targeting the enterotoxin as a therapeutic for ovarian cancers.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).

Recombinant Human Caveolin-3

A synthetic peptide for use as a blocking control in assays to test for specificity of DPPA2 antibody, catalog no. 70R-2389

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ascc1 antibody, catalog no. 70R-9440

POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD

Levosimendan has been shown to act as a calcium sensitiser and increase cytosolic Ca2+ levels. It is an analog of the cardiac glycoside, ouabain. This drug has been shown to be effective for the treatment of congestive heart failure and is used to increase the heart’s contractility and decrease its rate in patients who have low cardiac output. Levosimendan also causes vasodilation by increasing nitric oxide production in vascular endothelial cells. Levosimendan is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Freshly prepared tissue lysate isolated from cerebellum of human brain

Purified recombinant ACAT1 protein

Peptide H-WY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WY-OH include the following: Identification of peptides mimicking the antigenicity and immunogenicity of conformational epitopes on Japanese encephalitis virus protein using synthetic peptide Y Hirabayashi, H Fukuda, J Kimura, M Miyamoto - Journal of virological , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0166093496020666 Self-Assembled Materials Based on Fully Aromatic Peptides: The Impact of Tryptophan, Tyrosine, and Dopa Residues N Balasco , D Altamura, PL Scognamiglio , T Sibillano - Langmuir, 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.langmuir.3c03214 Ultrafast proton coupled electron transfer between tryptophan and tyrosine in peptides Trp-Pron-Tyr H Li , S Cao, S Zhang, J Chen , J Xu - Chinese Journal of Chemical , 2023 - pubs.aip.orghttps://pubs.aip.org/cps/cjcp/article/36/4/384/2912084 Spontaneous formation of hydrophobic domains in isolated peptides E Gloaguen , Y Loquais, JA Thomas - The Journal of , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jp401499x A novel insight into screening for antioxidant peptides from hazelnut protein: based on the properties of amino acid residues C Shi, M Liu, H Zhao, Z Lv, L Liang, B Zhang - Antioxidants, 2022 - mdpi.comhttps://www.mdpi.com/2076-3921/11/1/127 ACE-inhibitory and radical-scavenging activity of peptides derived from beta-lactoglobulin f (19-25). Interactions with ascorbic acid B Hernandez-Ledesma, L Amigo, I Recio - Journal of Agricultural , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf063427j Sequence-specific Ni (II)-dependent peptide bond hydrolysis for protein engineering: Active sequence optimization AM Protas, HHN Ariani , A Bonna - Journal of inorganic , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162013413002018

Human s-IgA (Saliva) ELISA (1ea) is a human IgA immunoglobulin that is found in saliva. It is used to detect the presence of antibodies against specific substances such as drugs, food, and other allergens.

This antibody can be used as a Human IgG detection or capture antibody in a variety of immunoassays.

The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell growth and division, making it an important target for cancer treatment. The EGFR antibody works by binding to the EGFR on the surface of cancer cells, blocking its activation and preventing further cell proliferation. This antibody is widely used in life sciences research and clinical applications. It has been shown to effectively inhibit tumor growth and metastasis in various types of cancers, including lung, breast, colorectal, and head and neck cancers. Additionally, the EGFR antibody has shown promising results in combination with other therapies, such as chemotherapy and radiation therapy. The EGFR antibody is available as both monoclonal antibodies and polyclonal antibodies. Monoclonal antibodies are highly specific and have a higher affinity for the target antigen, while polyclonal antibodies offer a broader range of binding sites. In addition to its use in cancer treatment, the

Furacilinum metabolite-OVA

Affinity purified Rabbit polyclonal CD54 antibody

Peptide H-EILVGDVGQTVDDPYATFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EILVGDVGQTVDDPYATFVK^-OH include the following: Identification of biomarkers for bone union promoted by mechanical stimulation Y Guo, S Guo, N Lu, Y Chai, X Yu - Frontiers in Bioscience , 2015 - article.imrpress.comhttps://article.imrpress.com/bri/Landmark/articles/pdf/Landmark4356.pdf Integration of the deep learning prediction tool Prosit into Skyline for high-accuracy, on-demand fragment intensity and iRT prediction T Rohde, T Schmidt, B Kuster , MJ MacCoss - Proceedings of the 68th , 2020 - skyline.mshttps://skyline.ms/_webdav/home/software/Skyline/%40files/2019-ASBMB-Rohde.pdf Over-expression of cofilin-1 and phosphoglycerate kinase 1 in astrocytomas involved in pathogenesis of radioresistance H Yan, K Yang, H Xiao, YJ Zou - CNS neuroscience & , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1755-5949.2012.00353.x

D15WSU75E antibody was raised using the middle region of D15Wsu75E corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ

Sheep polyclonal Clostebol antibody

(S, R, S)-AHPC-PEG4-acid

ProTx-II is a synthetic peptide that activates the TRPV1 receptor, a member of the capsaicin receptor family. ProTx-II has been shown to inhibit NGF-induced neurite outgrowth, and can be used as a research tool in studying the structure and function of TRPV1 receptors. ProTx-II is also an inhibitor of protein interactions with the TNF receptor, and has been shown to selectively inhibit NFκB activation by inhibiting IKK kinase activity.

Z-1-Bromononadeca-4,7,10,13-tetraene

MK-1064 is a pyrazole compound that has been shown to possess antitumor activity. The antitumor activity of MK-1064 is based on its ability to bind with high affinity to wild-type human liver cancer cells in vitro and in vivo, as well as its ability to inhibit the proliferation of these cells. MK-1064 also binds with high affinity to human liver, but not other organs such as kidney or lung. This drug has been shown to be safe and effective in women with breast cancer and humans with liver cancer, although it has not been tested in men. The clinical development of MK-1064 was terminated due to lack of efficacy.

Rifaximin-d6 is a peptide. It is an activator of ion channels and a ligand for receptors and ligands. Rifaximin-d6 has been shown to inhibit the activity of protein interactions and can be used as a research tool for studies in cell biology, pharmacology, and immunology. Rifaximin-d6 is a high purity product with CAS No. 1262992-43-7.

Mouse monoclonal CD16 antibody

Peptide H-TKAKRRVVQREKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TKAKRRVVQREKR-OH include the following: Analysis of the immunogenic properties of a single-chain polypeptide analogue of the HIV-1 gp120-CD4 complex in transgenic mice that produce human Y He, P D'Agostino, A Pinter - Vaccine, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X03004511 Matrix-assisted laser desorption ionization/mass spectrometry mapping of human immunodeficiency virus-gp120 epitopes recognized by a limited polyclonal antibody S Jeyarajah, CE Parker, MT Sumner - Journal of the American , 1998 - Springerhttps://link.springer.com/article/10.1016/s1044-0305(97)00247-x Immunogenicity and antigenicity of conserved peptides from the envelope of HIV-1 expressed at the surface of recombinant bacteria A Charbit , A Molla, J Ronco, JM Clement, V Favier - Aids, 1990 - journals.lww.comhttps://journals.lww.com/aidsonline/abstract/1990/06000/Immunogenicity_and_antigenicity_of_conserved.8.aspx

The Morphine antibody is a highly specialized monoclonal antibody that plays a crucial role in various aspects of Life Sciences. This antibody specifically targets and neutralizes the effects of morphine, a potent painkiller and opioid drug. By binding to morphine molecules, the antibody prevents their interaction with receptors in the body, thereby inhibiting their cytotoxic and growth factor properties. One of the key functions of the Morphine antibody is its ability to induce apoptosis (programmed cell death) in cells that have been activated by morphine. This property makes it an invaluable tool for researchers studying the effects of morphine on cellular processes and developing potential treatments for addiction or overdose. Furthermore, this monoclonal antibody has been shown to be effective in lysing (destroying) cells that express high levels of collagen, which is often associated with certain autoimmune disorders. By targeting collagen-expressing cells, the Morphine antibody helps regulate immune responses and maintain iron homeostasis within the body. In summary, the

Please enquire for more information about Pigment Red 58:2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-DSRPTAPGNSPGIGN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSRPTAPGNSPGIGN-OH include the following: Overexpression of Peptide-Encoding OsCEP6.1 Results in Pleiotropic Effects on Growth in Rice (O. sativa) Z Sui, T Wang, H Li, M Zhang, Y Li, R Xu - Frontiers in plant , 2016 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fpls.2016.00228/full

Peptide Ac-GNPARARERLKNIERIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-GNPARARERLKNIERIC-NH2 include the following: Cornichon-like protein facilitates secretion of HB-EGF and regulates proper development of cranial nerves H Hoshino, T Uchida, T Otsuki - Molecular biology of , 2007 - Am Soc Cell Biolhttps://www.molbiolcell.org/doi/abs/10.1091/mbc.E06-08-0733

Rabbit Polyclonal Phosphotyrosine antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS4 antibody, catalog no. 70R-4487

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit polyclonal ATF2 antibody

2,3-Dihydroxypropyl (8Z)-8-heptadecenoate is a synthetic ester compound often utilized in biochemical research and lipid metabolism studies. This compound is derived through the esterification of 2,3-dihydroxypropanol with (8Z)-8-heptadecenoic acid, typically sourced from advanced chemical synthesis processes. Its mode of action involves participating in lipid pathways as a biochemical mimic, providing insights into enzymatic activities and metabolic regulation associated with lipid molecules. Primarily, 2,3-Dihydroxypropyl (8Z)-8-heptadecenoate serves as a model substrate in the examination of lipid interactions and enzymatic cleavage, helping scientists investigate lipid signal transduction and storage mechanisms. Its applications extend to research environments where understanding complex lipid roles in cell membranes and energy storage is crucial. The compound's ability to simulate natural lipid structures allows researchers to elucidate various biochemical pathways and contributes to the development of targeted therapeutic strategies in metabolic disease research.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

SKF-86002

A synthetic peptide for use as a blocking control in assays to test for specificity of GCG antibody, catalog no. 70R-6207

HAS1 antibody was raised in Mouse using a purified recombinant fragment of human HAS1 expressed in E. coli as the immunogen.

H-RAHYNIVTF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RAHYNIVTF-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RAHYNIVTF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RAHYNIVTF-OH at the technical inquiry form on this page

3,6-Di-O-acetyl-2-azido-2-deoxy-?-D-glucopyranose

Mouse monoclonal SSX1 antibody

NCAPD3/hCAP-D3 Monoclonal Antibody

H-NLYGDSNPQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NLYGDSNPQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NLYGDSNPQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NLYGDSNPQK-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of IL13RA2 antibody, catalog no. 70R-1949

α-Galactosidase 95A from Bacteroides ovatus

L-Glutamic acid dimethyl ester hydrochloride is used as a pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Rabbit polyclonal 4EBP1 antibody

Peptide H-GTVGGYFLAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GTVGGYFLAGR-OH include the following: Empagliflozin reduces Ca/calmodulin-dependent kinase II activity in isolated ventricular cardiomyocytes J Mustroph, O Wagemann, CM Lücht, M Trum- ESC heart ..., 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ehf2.12336

H-NLKRAFSLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NLKRAFSLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NLKRAFSLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NLKRAFSLK-OH at the technical inquiry form on this page

Antibiotic for gram-negative bacteria Polymyxin B Sulfate is an antibiotic mixture active against gram (-) organisms. It is also reported to inhibit Ca2+ dependent PKC (protein kinase C). This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Region of Epiregulin protein corresponding to amino acids MVAQVSITKC SSDMNGYCLH GQCIYLVDMS QNYCRCEVGY TGVRCEHFFL.

Trpv6 antibody was raised in rabbit using the middle region of Trpv6 as the immunogen

1-248 amino acids: MERASLIQKA KLAEQAERYE DMAAFMKGAV EKGEELSCEE RNLLSVAYKN VVGGQRAAWR VLSSIEQKSN EEGSEEKGPE VREYREKVET ELQGVCDTVL GLLDSHLIKE AGDAESRVFY LKMKGDYYRY LAEVATGDDK KRIIDSARSA YQEAMDISKK EMPPTNPIRL GLALNFSVFH YEIANSPEEA ISLAKTTFDE AMADLHTLSE DSYKDSTLIM QLLRDNLTLW TADNAGEEGG EAPQEPQS

A synthetic peptide for use as a blocking control in assays to test for specificity of FAS antibody, catalog no. 70R-3743

Peptide H-EFTPQVQAAYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EFTPQVQAAYQK-OH include the following: Accumulation of glial fibrillary acidic protein and histone H4 in brain storage bodies of Tibetan terriers with hereditary neuronal ceroid lipofuscinosis ML Katz, DN Sanders, BP Mooney - Journal of inherited , 2007 - Springerhttps://link.springer.com/article/10.1007/s10545-007-0683-y Plasmodium vivax trophozoite-stage proteomes DC Anderson, SA Lapp , S Akinyi, EVS Meyer - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391914005636

H-PGSSSSLSLRERWTVFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PGSSSSLSLRERWTVFK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PGSSSSLSLRERWTVFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PGSSSSLSLRERWTVFK-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RASGEF1C antibody, catalog no. 70R-5807

GTF2I antibody was raised in Rabbit using Human GTF2I as the immunogen

Mouse monoclonal SNTA1 antibody

This antibody reacts with heavy chains on human IgM (mu chain).

Please enquire for more information about (+/-)-Lisofylline-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page

GC 376 is an inhibitor of the main protease Mpro (3CLpro) in coronaviruses as well as picornaviruses. This broad-spectrum antiviral compound has been used as investigational veterinary drug for treatment of feline infectious peritonitis virus (FIPV) infections. Recent studies also showed that GC 376 inhibits the main protease Mpro (3CLpro) from SARS-CoV-2 with IC50 of 0.03 μM and EC50 of 3.37 μM.

HSV2 gD antibody was raised in mouse using purified HSV from strain BH as the immunogen.

Mouse anti-Human Testosterone Antibody

H-KTVLPVTIMSGLVFH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KTVLPVTIMSGLVFH-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KTVLPVTIMSGLVFH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KTVLPVTIMSGLVFH-OH at the technical inquiry form on this page

H-SILPYPY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SILPYPY-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SILPYPY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SILPYPY-OH at the technical inquiry form on this page