Biochemicals and Reagents

H-ARLDVASEFRKKWNKWALSR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ARLDVASEFRKKWNKWALSR-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ARLDVASEFRKKWNKWALSR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ARLDVASEFRKKWNKWALSR-NH2 at the technical inquiry form on this page

Rabbit polyclonal ZNF791 antibody

Goat anti-rabbit IgG (Fab'2) (FITC) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.

1,2-Dimyristoyl-sn-glycero-3-phosphocholine (DMPC) is a lipid used as a research tool for studying the interactions between proteins. DMPC has been shown to inhibit antibody binding and cell signaling, suggesting that it can be used as an inhibitor or activator of protein interactions. DMPC is also used in pharmacology and life sciences to study ion channels, receptors, and ligands. It has a high purity level of 99% and is available at low cost.

Peptide Ac-WDWDWDWDWDWDWDWDWDWD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-WDWDWDWDWDWDWDWDWDWD-NH2 include the following: Surfactant mechanism of gene activation by transcriptional activation domains of sequence-specific factors BK Broyles, Y Tamara - Nature structural molecular biology, 2022 - par.nsf.govhttps://par.nsf.gov/biblio/10340347

Beta-Defensin-1 (BD-1) is an antimicrobial peptide that is produced by various cells and tissues in mice, including epithelial cells in the skin, lungs, and intestines. BD-1 is a member of the beta-defensin family, which are small cationic peptides that play a role in innate immunity by protecting against microbial pathogens, including bacteria, fungi, and viruses. In mice, BD-1 is constitutively expressed, meaning that it is produced at a relatively constant level in healthy animals. Its expression can be induced by various stimuli, including bacterial and viral infections, cytokines, and inflammatory mediators. BD-1 is known to have broad-spectrum antimicrobial activity against a variety of pathogens, including Staphylococcus aureus, Pseudomonas aeruginosa, and Candida albicans. It achieves its antimicrobial activity by disrupting the cell membranes of the pathogens, leading to cell lysis and death. In addition to its antimicrobial activity, BD-1 has been found to have other functions in mice, including promoting wound healing, regulating inflammation, and modulating the immune response.

MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Rabbit polyclonal Dysferlin antibody

MAGOH antibody was raised in Rabbit using Human MAGOH as the immunogen

Peptide H-QDIENEEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QDIENEEKI-OH include the following: Db-binding peptides from influenza virus: effect of non-anchor residues on stability and immunodominance LJ Sigal , P Goebel, DE Wylie - Molecular immunology, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0161589095000319 Interactions of murine MCH D (b) class I molecules with immunogenic peptides, beta2-microglobulin and the T cell receptor LJ Sigal - 1994 - search.proquest.comhttps://search.proquest.com/openview/80810874e56667bc7c1244f7f0938032/1?pq-origsite=gscholar&cbl=18750&diss=y

NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP

MPO/PANCA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about MPO/PANCA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Rabbit polyclonal OR8K1 antibody

Rabbit polyclonal CYB5 antibody

PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

NT5C1A antibody was raised in rabbit using the C terminal of NT5C1A as the immunogen

Purified native Influenza A H3N2 protein (Panama)

CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN

Please enquire for more information about [Ser25]-PKC (19 - 31), biotinylated including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about N-Despropyl-N-methyl macitentan including the price, delivery time and more detailed product information at the technical inquiry form on this page

Human sequence expressed in E. coli Cells; purity >90% by SDS Page and HPLC.

Azido-dPEG®12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Apo-A1 Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Apo-A1 Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

H-VKQYDQILIEICGKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VKQYDQILIEICGKK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VKQYDQILIEICGKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VKQYDQILIEICGKK-OH at the technical inquiry form on this page

GPRC5B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

P-selectin is a protein that belongs to the group of selectins, which are receptors found on the surfaces of cells. P-selectin is a receptor for phosphatidylserine (PS) and binds to PS on the surface of activated platelets, neutrophils, and macrophages. P-selectin is also an activator of the complement system, which is a series of proteins that work together in sequence to attack and destroy foreign materials such as bacteria or viruses. The recombinant human P-selectin is a research tool that can be used in cell biology experiments. It has been shown to be an excellent inhibitor of ion channels and ligands.

Peptide H-SVSELPIMHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SVSELPIMHQDWLNGK^-OH include the following: Analysis of deamidation artifacts induced by microwave-assisted tryptic digestion of a monoclonal antibody T Formolo, A Heckert, KW Phinney - Analytical and bioanalytical chemistry, 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-8043-x A Liquid Chromatography-Tandem Mass Spectrometry Method for Determination of Ocrelizumab in Serum of Patients with Multiple Sclerosis P Matlak, H Brozmanova, P Sistik, D Moskorova - Available at SSRN - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=4861160 Improving Quantification of Protein Therapeutics by Standardising the Sample Preparation Approach to LC-MS/MS Analysis: High-sensitivity Bioanalysis of EE Chambers, ME Lame - 2016 - researchgate.nethttps://www.researchgate.net/profile/Karen-Haas/publication/303483394_Improving_Quantification_of_Protein_Therapeutics_by_Standardising_the_Sample_Preparation_Approach_to_LC-MSMS_Analysis_High-sensitivity_Bioanalysis_of_Infliximab_and_Total_Antibody_Quantification_of_th/links/5744963c08ae9ace8421a432/Improving-Quantification-of-Protein-Therapeutics-by-Standardising-the-Sample-Preparation-Approach-to-LC-MS-MS-Analysis-High-sensitivity-Bioanalysis-of-Infliximab-and-Total-Antibody-Quantification-of.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF431 antibody, catalog no. 70R-8405

Rabbit polyclonal p38 MAPK antibody (Tyr322)

Rabbit polyclonal RAF1 antibody

CD 3254 is a biocidal agent, which is synthesized through a proprietary chemical process involving quaternary ammonium compounds. This agent acts by disrupting the cell membranes of bacteria, leading to cell lysis and death. The mode of action involves binding to the negatively charged bacterial cell surfaces, which compromises cell integrity and ultimately results in the leakage of cytoplasmic contents. CD 3254 is primarily employed in industrial applications, where it is used to ensure sanitary conditions in facilities such as food processing plants, pharmaceutical environments, and other areas requiring stringent microbial control. Due to its high efficacy and broad-spectrum activity, it is particularly valuable in settings where control of microbial proliferation is critical to product safety and compliance with regulatory standards. Despite its potent action on microorganisms, CD 3254 is formulated to minimize corrosive effects on equipment, thus offering a balance between efficacy and material compatibility.

Desmin protein is a growth factor and cell antigen that plays a crucial role in endothelial growth. It is commonly used in the field of Life Sciences for research purposes. Desmin protein can be detected using monoclonal antibodies, which specifically bind to this protein. This recombinant protein has various applications, including the study of interleukin-6, lipase, phosphatase, fibrinogen, and triglyceride lipase. Additionally, Desmin protein is also used in the detection of autoantibodies and amyloid plaque formation. Its versatility makes it an essential tool for researchers in the field of Proteins and Antigens.

Please enquire for more information about Dehydro indapamide-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide Protein Kinase A Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Protein Kinase A Substrate include the following: Selective sensing of phosphorylated peptides and monitoring kinase and phosphatase activity with a supramolecular tandem assay Y Liu , J Lee, L Perez , AD Gill , RJ Hooley - Journal of the , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.8b08693 Identification of Ser-55 as a major protein kinase A phosphorylation site on the 70-kDa subunit of neurofilaments. Early turnover during axonal transport. RK Sihag, RA Nixon - Journal of Biological Chemistry, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818551437 A potential pitfall in protein kinase assay: phosphocellulose paper as an unreliable adsorbent of produced phosphopeptides R Toomik, P Ekman, L Engström - Analytical biochemistry, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0003269792902442 Protein kinase A signalling in Schistosoma mansoni cercariae and schistosomules NL Hirst, SP Lawton, AJ Walker - International journal for parasitology, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0020751916000023 Interaction of the GTP-binding protein Gi2 with a protein kinase A-like kinase in mouse fibroblasts MF Crouch, DA Jans , L Simson - Australian and New , 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1445-5994.1995.tb02888.x protein kinase A-like zyxwvutsrqp kinase in mouse fibroblasts zyxwvutsrqpo L Simson, IA Hendry, DA Jans - Aust NZ J Med, 1995 - academia.eduhttps://www.academia.edu/download/50947495/j.1445-5994.1995.tb02888.x20161218-14836-189r9sv.pdf Development and application of technologies to study individual kinase substrate relationships JJ Allen - 2008 - search.proquest.comhttps://search.proquest.com/openview/b06fa63774ae4d9d2f2eb4945e3759a3/1?pq-origsite=gscholar&cbl=18750 A microPLC-based approach for determining kinase-substrate specificity J Wu, S Vajjhala, S O'Connor - ASSAY and Drug Development , 2007 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/adt.2007.072 Analysis of protein kinase A activity in insulin-secreting cells using a cell-penetrating protein substrate and capillary electrophoresis F Rauf, Y Huang, TP Muhandiramlage - Analytical and , 2010 - Springerhttps://link.springer.com/article/10.1007/s00216-010-3776-7 Insulin-activated protein kinases phosphorylate a pseudosubstrate synthetic peptide inhibitor of the p70 S6 kinase. DJ Price, NK Mukhopadhyay, J Avruch - Journal of Biological Chemistry, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818552911 Fully automated synthesis of (phospho) peptide arrays in microtiter plate wells provides efficient access to protein tyrosine kinase characterization C Saxinger, TP Conrads , DJ Goldstein, TD Veenstra - BMC immunology, 2005 - Springerhttps://link.springer.com/article/10.1186/1471-2172-6-1 Phosphorylation of nitric oxide synthase by protein kinase A B Brune, EG Lapetina - Biochemical and biophysical research , 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006291X9191279L Single-subunit allostery in the kinetics of peptide phosphorylation by protein kinase A A Kuznetsov, J Jarv - Proceedings of the Estonian Academy of , 2008 - academia.eduhttps://www.academia.edu/download/52383171/Single-subunit_allostery_in_the_kinetics20170330-24316-1yytpsg.pdf

Catalogue peptide; min. 95% purity

Rabbit polyclonal BHMT antibody (biotin)

Peptide H-QSLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QSLDL-OH include the following: Motlow State Community College Lynchburg, Tennessee GA Johansen - Journal of The Tennessee Academy of , 2014 - search.proquest.comhttps://search.proquest.com/openview/23acc40428f54706d18ebd32bd4885d9/1?pq-origsite=gscholar&cbl=75892

Please enquire for more information about Mefuparib hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CSF1 antibody, catalog no. 70R-6241

Antagonist of purine receptor P2Y1

Peptide H-VYTVDLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYTVDLGR^-OH include the following: mTRAQ-based quantification of potential endometrial carcinoma biomarkers from archived formalin-fixed paraffin-embedded tissues LV DeSouza, O Krakovska, MM Darfler - , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000082 Absolute quantification of potential cancer markers in clinical tissue homogenates using multiple reaction monitoring on a hybrid triple quadrupole/linear ion trap LV DeSouza, AD Romaschin, TJ Colgan - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac802726a

[13C18,15N3]-Hepcidin (Human) has reported disulfide bonds between Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22. and is a Stable Isotope-Labeled Peptide for Mass Spectrometric Detection of Hepcidin (Human). This product is available as a Trifluoroacetate Salt. Hepcidin is a peptide hormone that regulates iron metabolism by limiting the amount of iron that can be absorbed from the intestines. It is synthesized in the liver and secreted into the blood as a prohormone.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAD2L1BP antibody, catalog no. 70R-10299

QX77 is an innovative synthetic compound, which is a product of advanced organic synthesis processes. It functions through the modulation of active gene transcription pathways by selectively interacting with specific DNA sequences. This selective interaction enables the precise upregulation or downregulation of target genes within cellular environments. The primary applications of QX77 include research and development in genomics and therapeutic gene interventions. In genomic studies, QX77 serves as a critical tool for dissecting complex biological pathways, allowing scientists to understand gene regulatory networks more thoroughly. In therapeutic settings, its ability to precisely modulate gene expression has promising implications for the treatment of genetic disorders, where aberrant gene activity needs correction. Furthermore, QX77's specificity and reliability make it an invaluable agent for developing advanced gene therapies aimed at a variety of conditions, providing opportunities for innovative treatment paradigms.

The Chlorpyrifos antibody is a highly specialized protein that has been developed for use in the field of Life Sciences. This antibody is designed to specifically target and neutralize the effects of chlorpyrifos, a widely used insecticide. It works by binding to the chlorpyrifos molecules and preventing them from interacting with their intended targets. One of the unique features of this antibody is its ability to recognize both low-molecular-weight and high-molecular-weight forms of chlorpyrifos. This means that it can effectively neutralize different forms of the insecticide, making it highly versatile and effective in various applications. The Chlorpyrifos antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the option that best suits their specific needs. Both types have been extensively tested and proven to be highly specific and sensitive in their recognition of chlorpyrifos. In addition to its cytotoxic properties against chlorpyrifos, this antibody has also shown potential as an

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA10 antibody, catalog no. 70R-6166

Helicobacter pylori antibody is a monoclonal antibody that specifically targets the Helicobacter pylori bacteria. This antibody is used for diagnostic purposes to detect the presence of H. pylori in human serum samples. It works by binding to specific antigens on the surface of the bacteria, allowing for easy detection through particle chemiluminescence or colloidal methods. The Helicobacter pylori antibody can also be used as an anti-connexin agent, inhibiting connexin-mediated cell communication. Additionally, this antibody has been shown to have anticoagulant properties, possibly due to its interaction with phosphorylcholine or hydrogen atoms on the bacterial surface. With its high specificity and sensitivity, the Helicobacter pylori antibody is an essential tool in diagnosing and studying H. pylori infections.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM107 antibody, catalog no. 70R-8849

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-AVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVLQ-OH include the following: Spacer matters: All-peptide-based ligand for promoting interfacial proteolysis and plasmonic coupling Z Jin , C Ling , Y Li , J Zhou , K Li , W Yim , J Yeung - Nano Letters, 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.nanolett.2c03052 Peptide valence-induced breaks in plasmonic coupling YC Chang , Z Jin , K Li , J Zhou , W Yim , J Yeung - Chemical , 2023 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2023/sc/d2sc05837e Covalent adduction of serotonin-derived quinones to the SARS-CoV-2 main protease expressed in a cultured cell Y Kato , A Sakanishi, K Matsuda, M Hattori - Free Radical Biology , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0891584923005051 Engineering SpyCatcher Variants with Proteolytic Sites for Less-Trace Ligation XJ Zhang, XL Wu , D Liu, XD Da - Chinese Journal of , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cjoc.201800475 Goldilocks energy minimum: Peptide-based reversible aggregation and biosensing W Yim , M Retout, AA Chen, C Ling - Applied Materials & , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsami.3c09627 Fluorogenic tagging methodology applied to characterize oxidized tyrosine and phenylalanine in an immunoglobulin monoclonal antibody S Zhou, O Mozziconacci, BA Kerwin - Pharmaceutical , 2013 - Springerhttps://link.springer.com/article/10.1007/s11095-012-0970-7 Polyprotein cleavage mechanism of SARS CoV Mpro and chemical modification of the octapeptide QS Du, SQ Wang, Y Zhu, DQ Wei , H Guo, S Sirois - Peptides, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978104002797 Identification and characterisation of peptides from a boarfish (Capros aper) protein hydrolysate displaying in vitro dipeptidyl peptidase-IV (DPP-IV) inhibitory and PA Harnedy-Rothwell, CM McLaughlin - Food Research , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996920300144 Analysis of the efficacy of HIV protease inhibitors against SARS-CoV-2' s main protease M Mahdi , JA Motyan , ZI Szojka, M Golda, M Miczi - Virology journal, 2020 - Springerhttps://link.springer.com/article/10.1186/s12985-020-01457-0 Gold-based metal drugs as inhibitors of coronavirus proteins: The inhibition of sars-cov-2 main protease by auranofin and its analogs L Massai , D Grifagni, A De Santis, A Geri, F Cantini - Biomolecules, 2022 - mdpi.comhttps://www.mdpi.com/2218-273X/12/11/1675 Inhibition mechanism of SARS-CoV-2 main protease by ebselen and its derivatives K Amporndanai , X Meng, W Shang, Z Jin - Nature , 2021 - nature.comhttps://www.nature.com/articles/s41467-021-23313-7 Crystallographic structure of wild-type SARS-CoV-2 main protease acyl-enzyme intermediate with physiological C-terminal autoprocessing site J Lee, LJ Worrall , M Vuckovic , FI Rosell - Nature , 2020 - nature.comhttps://www.nature.com/articles/s41467-020-19662-4 Molecular basis of COVID-19 pathogenesis FN Novikov , VS Stroylov , IV Svitanko - Russian Chemical , 2020 - iopscience.iop.orghttps://iopscience.iop.org/article/10.1070/RCR4961/meta Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases CP Chuck, C Chen, Z Ke , DCC Wan, HF Chow - European journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523412006575 Engineering a novel endopeptidase based on SARS 3CLpro CJ Kuo, YP Shih, D Kan, PH Liang - BioTechniques, 2009 - Future Sciencehttps://www.future-science.com/doi/abs/10.2144/000113303 High-throughput virtual screening and validation of a SARS-CoV-2 main protease noncovalent inhibitor A Clyde , S Galanie , DW Kneller , H Ma - Journal of chemical , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jcim.1c00851

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of TRAK1 antibody, catalog no. 70R-4215

Please enquire for more information about Tipranavir-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page

AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Phevamine A is a peptide inhibitor that binds to the β2 adrenergic receptor and blocks the activation of this receptor by its ligands. Phevamine A also has an agonistic effect on G-protein coupled receptors, including the β1 adrenergic receptor. This drug is used in research as a tool to study protein interactions, activator or inhibitor of protein function, and as a high purity reagent for life science applications.

IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.

Please enquire for more information about Bordetella Holmesii Positive Nasopharyngeal Swabs (Liquid) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Recombinant Mouse SOD2 protein with His tag

Losartan is an anti-hypertensive agent that is used to treat hypertension, diabetic nephropathy and has shown to reduce the risk of strokes. This drug is an angiotensin II receptor blocker and works to relax smooth muscles and lower blood pressure. Losartan is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

CACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids RQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH

Rabbit polyclonal JunD antibody

Purified Polyclonal RAB20 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARF1 antibody, catalog no. 70R-5876

Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.

Dengue NS1 antibody is a monoclonal antibody used in the field of Life Sciences. It plays a crucial role in inhibiting the growth of hepatocytes and has been extensively studied for its proteolytic activity. This antibody has shown promising results in DNA vaccines and has been found to be effective against various pathogens. Dengue NS1 antibody specifically targets acid residues and has been proven to inhibit plasmin activity, which is crucial for the replication of certain viruses. Furthermore, this antibody has demonstrated its effectiveness against gingivalis culture and has shown water-soluble properties. With its ability to interact with collagen and non-essential amino acids, Dengue NS1 antibody is a valuable tool in the field of immunology research.

Peptide H-LPLSLPVGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LPLSLPVGPR-OH include the following: Investigation of proteins in samples of a mid-18th century colonial mural painting by MALDI-TOF/MS and LC-ESI/MS (Orbitrap) IK Levy, RN Tauil, MP Valacco, S Moreno - Microchemical , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0026265X17308469 An easily transferable protocol for in-situ quasi-non-invasive analysis of protein binders in works of art CD Calvano , E Rigante, RA Picca , TRI Cataldi - Talanta, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914020301739

Recombinant Human PPM1D protein (His tag)

Didesmethyl cariprazine is a peptide that belongs to the group of activators. It has been shown to be an inhibitor of protein interactions and a ligand for the 5-HT2A receptor. Didesmethyl cariprazine has also been found to have pharmacological effects on ion channels and cell biology, such as life science.

HSF1 antibody was raised in rabbit using the C terminal of HSF1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of LACTB2 antibody, catalog no. 70R-4418

Purified Turkey IgG

Peptide H-DYKDDDDKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DYKDDDDKC-OH include the following: More than just Alkene Construction-Re-using Wittig Reactions/Reagents in Biomacromolecular Labeling, Imaging, Sequencing and Modification YM He, L Cheng - Analysis & Sensing - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/anse.202300098 Surface modification via strain-promoted click reaction facilitates targeted lentiviral transduction Y Chu , YH Oum , IS Carrico - Virology, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682215004006 Surface Remodeling of Lentiviral and Adeno-Associated Viral Vectors via Metabolically Introduced Bioorthogonal Functionalities Y Chu - 2015 - search.proquest.comhttps://search.proquest.com/openview/554a9e493884ae492d3aac0b49b137fb/1?pq-origsite=gscholar&cbl=18750 Tandem Wittig/Diels-Alder diversification of genetically encoded peptide libraries V Triana, R Derda - Organic & Biomolecular Chemistry, 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/ob/c7ob01635b Phage Display as a Combinatorial Chemistry Platform for Discovery of Chemical Structure-Activity Relationships V Triana Guzman - 2018 - era.library.ualberta.cahttps://era.library.ualberta.ca/items/1f840851-9538-4aa3-9147-420abd5a2616 Transgenic overexpression of SUR1 in the heart suppresses sarcolemmal KATP TP Flagg , MS Remedi , R Masia, J Gomes - Journal of molecular and , 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022282805001872 Interaction of receptor-activity-modifying protein1 with tubulin TH Kunz, S Mueller-Steiner, K Schwerdtfeger - et Biophysica Acta (BBA , 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304416507000803 Superbinder SH2 domains act as antagonists of cell signaling T Kaneko , H Huang , X Cao , X Li, C Li, C Voss - Science , 2012 - science.orghttps://www.science.org/doi/abs/10.1126/scisignal.2003021 Modulation of inositol 1, 4, 5-trisphosphate receptor type 2 channel activity by Ca2+/calmodulin-dependent protein kinase II (CaMKII)-mediated phosphorylation JT Maxwell, S Natesan , GA Mignery - Journal of Biological Chemistry, 2012 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)62240-2/abstract CaMKII-mediated phosphorylation of the inositol 1, 4, 5-trisphosphate receptor at serine-150 results in decreased channel activity JT Maxwell - 2010 - search.proquest.comhttps://search.proquest.com/openview/285a0fbcfb7dd2e1ac03f461af7447cf/1?pq-origsite=gscholar&cbl=18750 N-terminal alpha-amino group modification of antibodies using a site-selective click chemistry method D Li, B Han, R Wei, G Yao, Z Chen , J Liu, TCW Poon - MAbs, 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2018.1463122 Design and Characterization of Stimuli-Responsive FLAG-tag Analogues and the Illumination-Induced Modulation of Their Interaction with Antibody 4E11 C Pöhner, F Hilbrig, V JeracaŽme - Biotechnology , 2006 - Wiley Online Libraryhttps://aiche.onlinelibrary.wiley.com/doi/abs/10.1021/bp060011h Factor H-related (FHR)-1 and FHR-2 form homo-and heterodimers, while FHR-5 circulates only as homodimer in human plasma AE van Beek , RB Pouw , MC Brouwer - Frontiers in , 2017 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2017.01328/full

A synthetic peptide for use as a blocking control in assays to test for specificity of PCCB antibody, catalog no. 70R-5324

Goat anti-human lambda chain (Fab'2) (FITC) was raised in goat using human lambda light chain as the immunogen.

Biricodar dicitrate (vx-710 dicitrate) is a chemosensitizing agent, which is a synthetic compound designed to modulate drug resistance mechanisms. It is sourced from research efforts aimed at overcoming multidrug resistance in cancer. Biricodar dicitrate acts by inhibiting members of the ATP-binding cassette (ABC) transporter family, particularly P-glycoprotein (P-gp) and multidrug resistance-associated proteins (MRPs). These transporters typically efflux chemotherapeutic agents out of cancer cells, thereby reducing drug accumulation and efficacy. By blocking these transporters, Biricodar dicitrate allows for increased intracellular concentrations of chemotherapeutic agents, enhancing their cytotoxic effects against resistant cancer cells. This agent is particularly valuable in combination therapies where its role as a resistance modulator can significantly improve the response rate to treatment. Research into its clinical application has focused on various malignancies, highlighting its potential to reverse resistance in otherwise refractory cases and to improve overall treatment outcomes.

MAP3K7IP1 antibody was raised in Rabbit using Human MAP3K7IP1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A2 antibody, catalog no. 70R-6535

1-495 amino acids: MGSSHHHHHH SSGLVPRGSH MPQLLQNING IIEAFRRYAR TEGNCTALTR GELKRLLEQE FADVIVKPHD PATVDEVLRL LDEDHTGTVE FKEFLVLVFK VAQACFKTLS ESAEGACGSQ ESGSLHSGAS QELGEGQRSG TEVGRAGKGQ HYEGSSHRQS QQGSRGQNRP GVQTQGQATG SAWVSSYDRQ AESQSQERIS PQIQLSGQTE QTQKAGEGKR NQTTEMRPER QPQTREQDRA HQTGETVTGS GTQTQAGATQ TVEQDSSHQT GRTSKQTQEA TNDQNRGTET HGQGRSQTSQ AVTGGHAQIQ AGTHTQTPTQ TVEQDSSHQT GSTSTQTQES TNGQNRGTEI HGQGRSQTSQ AVTGGHTQIQ AGSHTETVEQ DRSQTVSHGG AREQGQTQTQ PGSGQRWMQV SNPEAGETVP GGQAQTGAST EPGRQEWSST HPRRCVTEGQ GDRQPTVVGE EWVDDHSRET VILRLDQGNL HTSVSSAQGQ DAAQSEEKRG ITARELYSYL RSTKP

Rabbit polyclonal NFKP p105/p50 antibody

Donkey anti-rabbit IgG (H+L) (HRP) was raised in donkey using rabbit IgG whole molecule as the immunogen.

CD3 antibody (FITC) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of GBL antibody, catalog no. 70R-3342

Affinity purified Rabbit polyclonal MALT1 antibody

Rat monoclonal T and B cell activation antigen antibody

The SHP2 antibody is a monoclonal antibody that specifically targets SHP2, a protein involved in various cellular processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications. One of the key characteristics of the SHP2 antibody is its ability to modulate human folate, growth factor, creatine, collagen, and hepatocyte growth. This makes it an essential tool for researchers studying these pathways and their effects on cellular functions. Additionally, the SHP2 antibody has been found to play a crucial role in mineralization and mesenchymal stem cell differentiation. By targeting SHP2, researchers can gain valuable insights into bone formation and tissue regeneration processes. Furthermore, this antibody has been extensively tested and validated for use in various experimental techniques. It can be used for immunohistochemistry, Western blotting, ELISA assays, and more. Its high specificity ensures accurate and reliable results in these experiments. In summary, the SHP

A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1A2 antibody, catalog no. 70R-9886

Rabbit polyclonal PLXDC1 antibody

Rabbit polyclonal hnRNPM antibody

Rabbit polyclonal ABHD4 antibody

Please enquire for more information about BNP antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-NIPRRIRQGFERALL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NIPRRIRQGFERALL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NIPRRIRQGFERALL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NIPRRIRQGFERALL-OH at the technical inquiry form on this page

Peptide H-FTISADTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FTISADTSK^-OH include the following: Streamlined workflow for absolute quantitation of therapeutic monoclonal antibodies using Promise Proteomics mAbXmise kits and a TSQ Altis Plus mass YE Song, D Lebert, JV Guillaubez, S Samra , E Goucher - promise-proteomics.comhttps://promise-proteomics.com/wp-content/uploads/2023/06/tn-001753-cl-clinical-altis-mabs-tn001753-na-en.pdf Conjugation site characterization of antibody-drug conjugates using electron-transfer/higher-energy collision dissociation (EThcD) Y Song, J Gao, Q Meng, F Tang, Y Wang, Y Zeng - Analytica Chimica , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S000326702300199X Development and validation of an LC-MS/MS method for simultaneous quantification of co-administered trastuzumab and pertuzumab S Schokker , F Fusetti, F Bonardi, RJ Molenaar - MAbs, 2020 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2020.1795492 LC-MS/MS validation analysis of trastuzumab using dSIL approach for evaluating pharmacokinetics RH Budhraja , MA Shah, M Suthar, A Yadav , SP Shah - Molecules, 2016 - mdpi.comhttps://www.mdpi.com/1420-3049/21/11/1464 LC-MS/MS-Based Monitoring of In Vivo Protein Biotransformation: Quantitative Determination of Trastuzumab and Its Deamidation Products in Human Plasma P Bults , R Bischoff , H Bakker, JA Gietema - Analytical , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b04276 Analytical and pharmacological consequences of the in vivo deamidation of trastuzumab and pertuzumab P Bults , A van der Voort, C Meijer, GS Sonke - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03756-z Enrichment and Liquid Chromatography-Mass Spectrometry Analysis of Trastuzumab and Pertuzumab Using Affimer Reagents O Olaleye, B Spanov, R Ford, N Govorukhina - Analytical , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.1c02807 and Takashi Shimada N Iwamoto, N Yamane, Y Umino, A Hamadac - researchgate.nethttps://www.researchgate.net/profile/Akinobu-Hamada/publication/283003878_Development_of_the_validated_LCMS_bioanalysis_of_Trastuzumab_in_human_plasma_using_selective_detection_method_for_complementarity-determining_regions_of_monoclonal_antibody_nano-surface_and_molecular-/links/56582f5008aefe619b207dac/Development-of-the-validated-LCMS-bioanalysis-of-Trastuzumab-in-human-plasma-using-selective-detection-method-for-complementarity-determining-regions-of-monoclonal-antibody-nano-surface-and-molecular.pdf The development of the validated LCMS bioanalysis of trastuzumab in human plasma using a selective detection method for complementarity-determining regions of N Iwamoto, N Yamane, Y Umino, A Hamada - Analytical , 2015 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2015/ay/c5ay01588j Hybrid ligand binding immunoaffinity-liquid chromatography/mass spectrometry for biotherapeutics and biomarker quantitation: how to develop a hybrid LBA M Yuan, OA Ismaiel , WRJ Mylott - Rev , 2019 - betasciencepress-publishing.comhttps://betasciencepress-publishing.com/10-17145/fulltext/rss/hybrid-ligand-binding-immunoaffinity-liquid-chromatography-mass-spectrometry-for-biotherapeutics-and-biomarker-quantitation-how-to-develop-a-hybrid-lba-lc-ms-ms-method-for-a-protein/ Use of an alternative signature peptide during development of a LC-MS/MS assay of plasma nivolumab levels applicable for multiple species M Ohuchi, S Yagishita , K Taguchi, Y Goto - of Chromatography B, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023220313659 Antibody Drug Conjugate Bioanalysis using the BioBA Solution M Deng, I Moore - sciex.jphttps://sciex.jp/content/dam/SCIEX/pdf/tech-notes/all/ADC-Bioanalysis-BioBA-solution.pdf Optimizing hybrid LC-MS/MS binding conditions is critical: impact of biotransformation on quantification of trastuzumab L Liu, K Xu, J Li, M Maia , M Mathieu, R Elliott , J Yang - Bioanalysis, 2018 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2018-0196 Simultaneous quantification of co-administered trastuzumab and pertuzumab in serum based on nano-surface and molecular-orientation limited (nSMOL) proteolysis L Liu, B Sun, J Cai, J Wang, W Liu, H Hu, S Chen - RSC advances, 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/ra/d4ra03060e Method development and validation of LC-MS/MS-based assay for the simultaneous quantitation of trastuzumab and pertuzumab in cynomolgus monkey serum and L Gui, L Li, L Dong, S Xiang, J Zhai - Biomedical , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/bmc.4903 Augmented clearance of nivolumab is associated with renal functions in chronic renal disease model rats K Taguchi, Y Hayashi, M Ohuchi, H Yamada - Drug Metabolism and , 2022 - ASPEThttps://dmd.aspetjournals.org/content/50/6/822.abstract Investigation of native and aggregated therapeutic proteins in human plasma with asymmetrical flow field-flow fractionation and mass spectrometry I Ramm , M Leeman , H Schagerlöf, IR Leon - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-022-04355-2 Development of an efficient mAb quantification assay by LC-MS/MS using rapid on-bead digestion HH Chiu , YJ Tsai, C Lo, CH Lin, IL Tsai, CH Kuo - Analytica Chimica Acta, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267021011454 Quantification of the Antibody Drug Conjugate, Trastuzumab Emtansine, and the Monocolonal Antibody, Trastuzumab, in Plasma Using a Generic Kit-Based H Yang, ME Lame, S Naughton, EE Chambers - waters.comhttps://www.waters.com/content/dam/waters/en/app-notes/2016/720005619/720005619-en.pdf Transition of average drug-to-antibody ratio of trastuzumab deruxtecan in systemic circulation in monkeys using a hybrid affinity capture liquid chromatography H Habara, H Okamoto, Y Nagai, M Oitate - & Drug Disposition, 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bdd.2371 Improving Quantification of Protein Therapeutics by Standardising the Sample Preparation Approach to LC-MS/MS Analysis: High-sensitivity Bioanalysis of EE Chambers, ME Lame - 2016 - researchgate.nethttps://www.researchgate.net/profile/Karen-Haas/publication/303483394_Improving_Quantification_of_Protein_Therapeutics_by_Standardising_the_Sample_Preparation_Approach_to_LC-MSMS_Analysis_High-sensitivity_Bioanalysis_of_Infliximab_and_Total_Antibody_Quantification_of_th/links/5744963c08ae9ace8421a432/Improving-Quantification-of-Protein-Therapeutics-by-Standardising-the-Sample-Preparation-Approach-to-LC-MS-MS-Analysis-High-sensitivity-Bioanalysis-of-Infliximab-and-Total-Antibody-Quantification-of.pdf UPLC-MS/MS Method for the Quantification of Trastuzumab in Human Serum at the 5-nM Level Using Xevo TQD MS and ACQUITY UPLC H-Class System CE Doneanu, RS Plumb - gimitec.comhttps://gimitec.com/file/720004423en.pdf TWO DIMENSIONAL LC-SRM ASSAY FOR TRASTUZUMAB IN HUMAN SERUM CE Doneanu, H Yang, P Rainville, S Berger, RS Plumb - waters.comhttps://www.waters.com/webassets/cms/library/docs/2013wcbp_doneanu_2dlc.pdf Single source solution for low flow chromatography C Hunter , L De Souza, C Seto, Y Kang, L Bedford - sciex.jphttps://www.sciex.jp/content/dam/SCIEX/pdf/tech-notes/all/Single-Source-Solution-for-Low-Flow-Chromatography.pdf Advantages of online two-dimensional chromatography for MRM quantification of therapeutic monoclonal antibodies in serum C Doneanu, P Rainville, RS Plumb - RADAR and PICS Compendium, 2012 - waters.comhttps://www.waters.com/content/dam/waters/en/app-notes/2012/720004510/720004510-ko.pdf Optimization of Trypsin Digestion for MRM Quantification of Therapeutic Proteins in Serum C Doneanu, H Yang, PD Rainville, E Bouvier - Waters , 2012 - waters.comhttps://www.waters.com/content/dam/waters/en/app-notes/2012/720004507/720004507-de.pdf Aptamer-based sample purification for mass spectrometric quantification of trastuzumab in human serum B Sun, J Liu, P Cai, J Wu, W Liu, H Hu, L Liu - Talanta, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914023001005

FLJ11730 antibody was raised using the N terminal Of Flj11730 corresponding to a region with amino acids HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM

Peptide H-ELSEALGQIFDSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELSEALGQIFDSQR-OH include the following: Antibody-mediated blockade for galectin-3 binding protein in tumor secretome abrogates PDAC metastasis YS Choi, MJ Kim, EA Choi, S Kim - Proceedings of the , 2022 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2119048119 Integration of 18O Labeling and Solution Isoelectric Focusing in a Shotgun Analysis of Mitochondrial Proteins J Wang, P Gutierrez, N Edwards - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr070401e Integration of oxygen-18 labeling and solution isoelectric focusing in a shotgun analysis of mitochondrial proteins J Wang - 2007 - search.proquest.comhttps://search.proquest.com/openview/e2e834beab184ff2bda1a6bed0fb04d8/1?pq-origsite=gscholar&cbl=18750

A synthetic peptide for use as a blocking control in assays to test for specificity of RARA antibody, catalog no. 70R-4609

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC37A4 antibody, catalog no. 70R-6793

Catalogue peptide; min. 95% purity

ENOX2 antibody was raised in Rabbit using Human ENOX2 as the immunogen

Purified recombinant Human CCNB2 Protein (His tag)

ApoA-I + B calibrator kit

Mouse monoclonal NUDT6 antibody

Purified Polyclonal GPR19 antibody

Humanized monoclonal antibody targeting the Fc region of IgE, potential therapy for allergic diseases

Rabbit polyclonal TSTA3 antibody (FITC)

Ceftiofur Conjugate for use in immunoassays

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of KDELR3 antibody, catalog no. 70R-7476

Purified Polyclonal Connexin 26 antibody

Mouse monoclonal DTYMK antibody

Mouse monoclonal PSMA4 antibody

Peptide H-AIWNVINWENVTER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AIWNVINWENVTER-OH include the following: Hypoxia-inducible factor 1alpha mediates the down-regulation of superoxide dismutase 2 in von Hippel-Lindau deficient renal clear cell carcinoma YH Gao, CX Li, SM Shen, H Li, GQ Chen, Q Wei - Biochemical and , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X13006608 High-level soluble expression of recombinant human manganese superoxide dismutase in Escherichia coli, and its effects on proliferation of the leukemia cell W Feng, S Mei, Y Wenjie, H Luyuan - Protein Expression and Purification, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592810003463

FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS

A synthetic peptide for use as a blocking control in assays to test for specificity of TPX2 antibody, catalog no. 70R-5626

Pan HLA DR-binding epitope (PADRE) is a universal peptide that activates CD4+ T cells which can be used as an agonist adjuvant.

Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Purified recombinant Mouse CD105 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of PROC antibody, catalog no. 70R-5495

Mouse monoclonal SDR9C7 antibody

BRCA2 (pSer3291)

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC28A antibody, catalog no. 70R-9315

IFN beta antibody was raised in goat using human interferon beta as the immunogen.

Synthetic antineoplastic agent

A synthetic peptide for use as a blocking control in assays to test for specificity of UBXN6 antibody, catalog no. 70R-9728

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM29A antibody, catalog no. 70R-3438

Mouse monoclonal CD68 antibody

SLD5 antibody was raised in rats which were immunized with murine SLD5. Rat spleen cells were isolated and fused with mouse melanoma in order to establish hybridoma cells.

m-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

H-FLARSALIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FLARSALIL-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FLARSALIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FLARSALIL-OH at the technical inquiry form on this page

Peptide H-LQAEAFQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LQAEAFQAR^-OH include the following: Quantification of total apolipoprotein E and its specific isoforms in cerebrospinal fluid and blood in Alzheimer's disease and other neurodegenerative diseases M Rezeli , H Zetterberg , K Blennow, A Brinkmalm - EuPA Open , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212968515300143 EuPA Open Proteomics M Rezeli , H Zetterberg , K Blennow, A Brinkmalm - cyberleninka.orghttps://cyberleninka.org/article/n/135520.pdf