Biochemicals and Reagents

H-ICTEMEKEGKISKIG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ICTEMEKEGKISKIG-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ICTEMEKEGKISKIG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ICTEMEKEGKISKIG-OH at the technical inquiry form on this page

Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYIHPF-OH include the following: Mass spectrometry of peptides and proteins using digestion by a grape cysteine protease at pH 3 Z Perutka, M Å ebela - Journal of mass spectrometry, 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4444 Integrating computational modeling and experimental assay to discover new potent ACE-inhibitory peptides Y Ren, Q Wang, S Chen, H Cao - Molecular Informatics, 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/minf.201300131 Absorption of casein antihypertensive peptides through an in vitro model of intestinal epithelium M del Mar Contreras , AI Sancho , I Recio, C Mills - Food Digestion, 2012 - Springerhttps://link.springer.com/article/10.1007/s13228-012-0020-2 Enhanced recombinant expression and purification of human IRAP for biochemical and crystallography studies L Sui , HC Guo - Biochemistry and Biophysics Reports, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2405580821001369 The specific isolation of C-terminal peptides of proteins through a transamination reaction and its advantage for introducing functional groups into the peptide K Sonomura, H Kuyama , E Matsuo - Journal Devoted to , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3920 Fragmentation mechanisms of oxidized peptides elucidated by SID, RRKM modeling, and molecular dynamics JM Spraggins , JA Lloyd, MV Johnston , J Laskin - Journal of the American , 2009 - Springerhttps://link.springer.com/article/10.1016/j.jasms.2009.04.012 Gold ion-angiotensin peptide interaction by mass spectrometry J Lee, LP Jayathilaka, S Gupta - Journal of the , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-011-0328-0 Structure-activity study of LVV-hemorphin-7: angiotensin AT4 receptor ligand and inhibitor of insulin-regulated aminopeptidase J Lee , T Mustafa, SG McDowall - of Pharmacology and , 2003 - ASPEThttps://jpet.aspetjournals.org/content/305/1/205.short A mechanistic investigation of the enhanced cleavage at histidine in the gas-phase dissociation of protonated peptides G Tsaprailis, H Nair, W Zhong , K Kuppannan - Analytical , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac034971j Study of secondary specificity of enteropeptidase in comparison with trypsin AG Mikhailova, VV Likhareva, BV Vaskovsky - Biochemistry , 2004 - Springerhttps://link.springer.com/article/10.1023/B:BIRY.0000040224.47278.3b

KLD 12 is a collagen with the amino acid sequence Gly-Xaa-Yaa-Gly-Xaa. It has been found to be an effective ingredient in the treatment of osteoarthritis, due to its ability to stimulate the synthesis of bone matrix components and inhibit the degradation of cartilage. KLD 12 also has shown growth factor activity, which may be due to its high concentration levels or ability to bind to cells via n-cadherin.

Human RBC antibody (FITC) was raised in rabbit using human erythrocytes as the immunogen.

PML antibody was raised in rabbit using the C terminal of PML as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431

Rabbit polyclonal TRAP1 antibody

Paraformaldehyde is used as a disinfectant, hardening agent and waterproofing agent. It is also used to prepare adhesives, resins and dentistry as an antiseptic and contraceptive. It is also employed as a thermoplastic. In addition, it is used in the preparation of formalin fixatives for tissues or cells during the samples subjected to florescence studies. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP antibody, catalog no. 70R-6235

Mouse monoclonal HA1C antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CHST1 antibody, catalog no. 70R-1892

Mouse monoclonal CD4 (T-cell receptor) antibody (HRP)

H-CGGAQKSRQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGAQKSRQR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGAQKSRQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGAQKSRQR-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of TIGD3 antibody, catalog no. 70R-1209

This product is an RGD Peptide containing a Thioacetyl Group for Linking to Liposomes. It may require further derivatization and deprotection before use

PSB 0777 is a peptide that is used as a research tool to study protein interactions and receptor signaling. PSB 0777 is an inhibitor of the P2X7 receptor, which has been shown to play a role in inflammation and pain. Research on this peptide has revealed its ability to block the activation of ion channels such as voltage-gated potassium channels and calcium channels. PSB 0777 also blocks ligand binding to receptors such as acetylcholine and histamine, which are involved in neurotransmission.

Rabbit polyclonal MASTL antibody

H-LPRFMNYTLNNTKKTNVTLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPRFMNYTLNNTKKTNVTLS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPRFMNYTLNNTKKTNVTLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPRFMNYTLNNTKKTNVTLS-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA2D1 antibody, catalog no. 70R-5102

Compound 3a is a synthetic herbicide, which is a laboratory-engineered chemical agent with a unique mode of action. It is derived through an intricate process involving chemical synthesis techniques that target specific biochemical pathways in plants. The mode of action of Compound 3a involves the inhibition of a critical enzyme in the photosynthetic pathway, leading to disrupted energy production and ultimately plant death. This selective herbicide is primarily used in agricultural settings to control broadleaf weeds and grasses, which compete with crops for resources such as nutrients, water, and light. By targeting specific plant types, Compound 3a ensures minimal impact on non-target plant species, making it a valuable tool in integrated weed management strategies. Its application can contribute to enhanced crop yields by maintaining a weed-free environment, demonstrating its significance in modern agronomy. Scientists continue to study Compound 3a for its potential environmental impact, efficacy across different crop systems, and resistance management.

H-EGVSFPWSRPPGQGEFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGVSFPWSRPPGQGEFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGVSFPWSRPPGQGEFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGVSFPWSRPPGQGEFR-OH at the technical inquiry form on this page

PEG7-Tos

Giardia lamblia antibody is a monoclonal antibody that specifically targets and binds to Giardia lamblia, a microscopic parasite that causes gastrointestinal infections in humans. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in diagnostic applications. It can be used in various immunoassays to detect the presence of Giardia lamblia antigens in human serum or other biological samples. The highly specific binding of this antibody to Giardia lamblia antigens allows for accurate and reliable detection, making it an invaluable tool for researchers and healthcare professionals. Additionally, molecular docking studies have revealed insights into the mechanism of action of this antibody, highlighting its ability to interact with specific tyrosine residues on the target antigen. With its activated colloidal properties and high affinity for Giardia lamblia antigens, this monoclonal antibody offers great potential for advancing our understanding and management of Giardiasis infections.

NFH antibody was raised in rabbit using repeated motif, XKSPYK domain [SPEKAKSPEKAKSC] of NFH as the immunogen.

Peptide Ac-LGRI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-LGRI-NH2 include the following: An abscisic-acid-responsive, low temperature barley gene has homology with a maize phospholipid transfer protein MA Hughes, MA Dunn, RS Pearce - Plant, Cell & , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-3040.1992.tb02155.x Purification and characterization of three chitinases and one beta-1, 3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.) KM Kragh, S Jacobsen, JD Mikkelsen, KA Nielsen - Plant Science, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016894529190219X The molecular structure of gelprotein from barley, its behaviour in wort-filtration and analysis JHE Moonen, A Graveland - Journal of the Institute of , 1987 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/j.2050-0416.1987.tb04489.x Primary sclerosing cholangitis: current and future management strategies JE Eaton, JA Talwalkar - Current hepatitis reports, 2013 - Springerhttps://link.springer.com/article/10.1007/s11901-012-0155-1 Recall processes for biliary cytology in primary sclerosing cholangitis JE Eaton, AA Gossard, JA Talwalkar - Current Opinion in , 2014 - journals.lww.comhttps://journals.lww.com/co-gastroenterology/FullText/2014/05000/Recall_processes_for_biliary_cytology_in_primary.12.aspx Plant regeneration, cryopreservation, and genetic transformation of napiergrass (Pennisetum purpureum Schum.) CH Wan - 1994 - search.proquest.comhttps://search.proquest.com/openview/96cc1fe7e779d6dc36485a2f71f26b67/1?pq-origsite=gscholar&cbl=18750&diss=y Transaldolase: from biochemistry to human disease AK Samland, GA Sprenger - The international journal of biochemistry & cell , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1357272509000557

6-Chloro-3-indolyl acetate

Rabbit polyclonal STAT4 antibody

H-VINRVRQGYSPLSLQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VINRVRQGYSPLSLQ-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VINRVRQGYSPLSLQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VINRVRQGYSPLSLQ-OH at the technical inquiry form on this page

SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG

H-EILNINQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EILNINQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EILNINQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EILNINQK-OH at the technical inquiry form on this page

Ethyl 2-amino-6-bromo-α-cyano-3-(ethoxycarbonyl)-4H-1-benzopyran-4-acetate is a synthetic peptide that blocks sodium and potassium channels. It has been shown to be an antagonist of the NMDA receptor, which is involved in long term potentiation. Ethyl 2-amino-6-bromo-α-cyano-3-(ethoxycarbonyl)-4H-1-benzopyran 4 acetate binds to the receptor site and prevents glutamate from binding, thereby inhibiting the activity of the channel. This agent also inhibits protein interactions and is used as a research tool for studying protein interactions. It is also an antibody inhibitor.

Normal Council Serum is a high-quality serum that contains a range of antibodies, interferon, and glycoproteins. It is derived from liver microsomes and is rich in lysine, which plays a crucial role in protein synthesis. This serum has been extensively tested for its antiviral properties and has shown significant activity against a variety of viruses. Additionally, Normal Council Serum contains lectins that have been proven to enhance immune response and promote the production of chemokines. It is widely used in life sciences research and veterinary applications due to its potent immunological effects. This serum is carefully formulated with excipients to ensure stability and efficacy. With its broad range of applications, Normal Council Serum is an essential tool for any researcher or veterinarian seeking to understand and manipulate the immune system.

Please enquire for more information about Vercirnon sodium including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ac-SYSMEAFRWGKPV-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SYSMEAFRWGKPV-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SYSMEAFRWGKPV-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SYSMEAFRWGKPV-NH2 at the technical inquiry form on this page

H-TLPVFPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLPVFPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLPVFPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLPVFPK-OH at the technical inquiry form on this page

Affinity purified Rabbit polyclonal beta Tubulin 8 antibody

Rabbit polyclonal SLC2A3 antibody

HGV antibody was raised in rabbit using residues 2268-2276 [CDKCEARQE] of HGV as the immunogen.

CD64 antibody (Fab'2) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant KLRK1 protein

Mouse monoclonal MPP3 antibody

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPTL7 antibody, catalog no. 70R-8822

KIAA0284 antibody was raised using the N terminal of KIAA0284 corresponding to a region with amino acids QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL

Purified Polyclonal NF kappaB p65 antibody

UBE2J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD

Purified recombinant CEND1 protein (His tag)

Purified recombinant DBR1 protein (His tag)

The MAP2 antibody is a polyclonal antibody that specifically targets the protein MAP2. This protein plays a crucial role in various cellular processes, including neuronal development and maintenance. The MAP2 antibody has been extensively studied in the field of life sciences and has shown great potential for research purposes. One of the key features of this antibody is its ability to neutralize the activity of MAP2. By binding to this protein, the antibody prevents its interaction with other molecules, thereby inhibiting its function. This makes the MAP2 antibody an invaluable tool for scientists studying the role of MAP2 in different biological processes. Furthermore, the MAP2 antibody has been shown to have high specificity and sensitivity, ensuring accurate and reliable results in experiments. It has been successfully used in various applications, including immunohistochemistry, western blotting, and ELISA. In addition to its scientific applications, the MAP2 antibody also holds potential therapeutic value. Studies have suggested that targeting MAP2 could have implications for various diseases, such

Goat ant- pig IgG Fc (HRP) was raised in goat using porcine IgG, Fc fragment as the immunogen.

Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.

Ac-CGK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CGK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CGK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CGK-NH2 at the technical inquiry form on this page

Alpha Synuclein antibody was raised in goat using a peptide; MPVDPDNEAYEMPSEE, as the immunogen.

Purified recombinant TARDBP protein (His tag)

Rabbit polyclonal SUCLG1 antibody

Peptide Ac-PKKKRKVEDPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-PKKKRKVEDPYC-NH2 include the following: Specific 3'-terminal modification of DNA with a novel nucleoside analogue that allows a covalent linkage of a nuclear localization signal and enhancement of DNA Y Ikeda, S Kawahara, K Yoshinari, S Fujita - , 2005 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.200400142 NLS bioconjugates for targeting therapeutic genes to the nucleus V Escriou, M Carriacašre, D Scherman, P Wils - Advanced drug delivery , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169409X02001849 Coupling of a targeting peptide to plasmid DNA using a new type of padlock oligonucleotide T Roulon, C Helacašne, C Escude - Bioconjugate chemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc025551o Use of synthetic peptides for non-viral gene delivery T Niidome , Y Katayama - Non-viral Gene Therapy: Gene Design and , 2005 - Springerhttps://link.springer.com/chapter/10.1007/4-431-27879-6_8 DNA immunisation with minimalistic expression constructs S Moreno , L Lopez-Fuertes, AJ Vila-Coro, F Sack - Vaccine, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X04000945 Priming of immune responses to hepatitis B surface antigen with minimal DNA expression constructs modified with a nuclear localization signal peptide R Schirmbeck, SA König-Merediz, P Riedl - Journal of molecular , 2001 - Springerhttps://link.springer.com/article/10.1007/s001090100227 HIV-1 infection of nondividing cells through the recognition of integrase by the importin/karyopherin pathway P Gallay, T Hope , D Chin - Proceedings of the , 1997 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.94.18.9825 Lipidic peptide dendrimers: Potential gene delivery agents for the treatment of haemophilia B MW O'Donnell - 2005 - search.proquest.comhttps://search.proquest.com/openview/efbcdc20ac6eda9010d463b99d69687c/1?pq-origsite=gscholar&cbl=2026366&diss=y Gene delivery: a single nuclear localization signal peptide is sufficient to carry DNA to the cell nucleus MA Zanta, P Belguise-Valladier - Proceedings of the , 1999 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.96.1.91 An NLS peptide covalently linked to linear DNA does not enhance transfection efficiency of cationic polymer based gene delivery systems M Van der Aa, GA Koning , C d'Oliveira - The Journal of Gene , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jgm.643 Nucleocytoplasmic transport of DNA: enhancing non-viral gene transfer KM Wagstaff , DA Jans - Biochemical Journal, 2007 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/406/2/185/42128 Peptide-functionalized dendrimer nanocarriers for targeted microdystrophin gene delivery J Hersh , JM Condor Capcha , C Iansen Irion , G Lambert - Pharmaceutics, 2021 - mdpi.comhttps://www.mdpi.com/1999-4923/13/12/2159 Nuclear location signal peptide-modified poly (ethyleneimine)/DNA complexes: An efficient gene delivery vector in vitro and in vivo H Zhang, Z Liang, W Li, F Li - Journal of bioactive and , 2013 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/0883911513483507 Emerging significance of plasmid DNA nuclear import in gene therapy FM Munkonge, DA Dean, E Hillery - Advanced drug delivery , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169409X03000504 Nuclear targeting of viral and non-viral DNA EH Chowdhury - Expert Opinion on Drug Delivery, 2009 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1517/17425240903025744 A dendrimer-like DNA-based vector for DNA delivery: a viral and nonviral hybrid approach D Luo , Y Li, SH Um , Y Cu - DNA vaccines: Methods and Protocols, 2006 - Springerhttps://link.springer.com/protocol/10.1385/1-59745-168-1:115 A Dendrimer-Like DNA-Based Vector for DNA Delivery D Luo , Y Li, SH Um , Y Cu - DNA Vaccines, 2008 - Springerhttps://link.springer.com/content/pdf/10.1385/1597451681.pdf#page=124 Form follows function: the design of minimalistic immunogenically defined gene expression (MIDGE®) constructs C Junghans, M Schroff - Plasmids for therapy , 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/pdf/10.1002/9783527612833#page=152 Cell-Penetrating Peptides as Vectors for Delivery of Nucleic Acids A Valkna, U Soomets , u Langel - Cell-Penetrating Peptides, 2002 - taylorfrancis.comhttps://www.taylorfrancis.com/chapters/edit/10.1201/9781420040777-19/cell-penetrating-peptides-vectors-delivery-nucleic-acids-andres-valkna-ursel-soomets-%C3%BClo-langel Evaluation of peptide-mediated nucleic acid delivery A Tomatsidou - 2013 - studenttheses.uu.nlhttps://studenttheses.uu.nl/bitstream/handle/20.500.12932/12820/A.Tomatsidou,%20Evaluation%20of%20peptide-mediated%20nucleic%20acid%20delivery.pdf?sequence=1

Purified native Influenza B protein (Tokyo)

Please enquire for more information about rac Talinolol-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page

BMeS-p-A is a new antibiotic that has been shown to be effective against gram-negative bacteria, such as E. coli and P. aeruginosa, and carbapenem-resistant bacteria such as K. pneumoniae. BMeS-p-A binds to the bacterial ribosome and prevents protein synthesis by inhibiting the peptidyl transferase activity of the ribosome. BMeS-p-A also appears to have photophysical properties, which may help with its diagnosing potential for bacterial strains and monitoring of fields.

Rabbit polyclonal MP68 antibody

Mouse monoclonal SLFNL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PWWP2B antibody, catalog no. 70R-2969

Rabbit Polyclonal JNK antibody (Thr183)

Peptide H-SPDIYNPQAGSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SPDIYNPQAGSLK^-OH include the following: Current challenges in detecting food allergens by shotgun and targeted proteomic approaches: a case study on traces of peanut allergens in baked cookies R Pedreschi , J Norgaard, A Maquet - Nutrients, 2012 - mdpi.comhttps://www.mdpi.com/2072-6643/4/2/132 Food allergen analysis: detection, quantification and validation by mass spectrometry M Planque, T Arnould , N Gillard - Allergen, 2017 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=TW2PDwAAQBAJ&oi=fnd&pg=PA7&dq=(%22H-SPDIYNPQAGSLK%5E-OH%22+OR+%22H-SPDIYNPQAGSLK-OH%22+OR+%22SPDIYNPQAGSLK%22+OR+%22NH2-Ser-Pro-Asp-Ile-Tyr-Asn-Pro-Gln-Ala-Gly-Ser-Leu-Lys%5E-OH%22+OR+%22SPDIYNPQAGSLK%5E%22)+AND+peptide&ots=hbHhB6i4S2&sig=udwGhMSSj-Jc5CBtMrcvJUIJh_g Food allergen analysis: detection, quantification and validation by mass spectrometry M Planque, T Arnould , N Gillard - Allergen, 2017 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=TW2PDwAAQBAJ&oi=fnd&pg=PA7&dq=(%22H-SPDIYNPQAGSLK%5E-OH%22+OR+%22H-SPDIYNPQAGSLK-OH%22+OR+%22SPDIYNPQAGSLK%22+OR+%22NH2-Ser-Pro-Asp-Ile-Tyr-Asn-Pro-Gln-Ala-Gly-Ser-Leu-Lys%5E-OH%22+OR+%22SPDIYNPQAGSLK%5E%22)+AND+peptide&ots=hbHhB6i4W3&sig=xjc0IcuPtjXgR87Di0mL2lbGItw Determination of peanut allergens in cereal-chocolate-based snacks: metal-tag inductively coupled plasma mass spectrometry immunoassay versus liquid M Careri, L Elviri , M Maffini, A Mangia - Journal Devoted to , 2008 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3427 Optimization of a sample preparation workflow based on UHPLC-MS/MS method for multi-allergen detection in chocolate: An outcome of the ThRAll project J Henrottin, R Pilolli, AC Huet, C van Poucke , C Nitride - Food Control, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0956713522004492 Proteomics-based approach to detect and identify major allergens in processed peanuts by capillary LC-Q-TOF (MS/MS) H Chassaigne, JV Norgaard - Journal of agricultural , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf063630e A Multimodal Understanding of Allergic Disease DM Croote - 2019 - search.proquest.comhttps://search.proquest.com/openview/31d842c40cc55719985edb9e0ce4b156/1?pq-origsite=gscholar&cbl=18750&diss=y Food allergen detection by mass spectrometry: The role of systems biology D Croote , SR Quake - NPJ systems biology and applications, 2016 - nature.comhttps://www.nature.com/articles/npjsba201622 Addressing complex matrix interference improves multiplex food allergen detection by targeted LC-MS/MS D Croote , I Braslavsky , SR Quake - Analytical chemistry, 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b01388 Global proteomic screening of protein allergens and advanced glycation endproducts in thermally processed peanuts CM Hebling, MA McFarland, JH Callahan - Journal of agricultural , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf303554t A targeted LC-MS/MS method for the simultaneous detection and quantitation of egg, milk, and peanut allergens in sugar cookies CC Boo, CH Parker, LS Jackson - Journal of AOAC International, 2018 - academic.oup.comhttps://academic.oup.com/jaoac/article-abstract/101/1/108/5653891 Particle-packed column versus silica-based monolithic column for liquid chromatography-electrospray-linear ion trap-tandem mass spectrometry multiallergen trace C Bignardi, L Elviri , A Penna, M Careri - of Chromatography A, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967310014007

Amyloid β Protein fragment 25-35

OCT4 antibody was raised in Mouse using a purified recombinant fragment of OCT4(aa193-360) expressed in E. coli as the immunogen.

Mal-PEG4-PFP

Affinity purified Rabbit polyclonal CDC2 antibody

H-GVWPANPAPITQTVIHTV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GVWPANPAPITQTVIHTV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GVWPANPAPITQTVIHTV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GVWPANPAPITQTVIHTV-OH at the technical inquiry form on this page

Arphamenine B is an enzyme inhibitor that inhibits metalloproteinases and serine proteases. It has been shown to be a potent osteoinductive agent in cell culture. Arphamenine B has also been found to have a depressant effect on the growth of cells in culture, with lysine residues as the probable site of action. Arphamenine B has also been shown to inhibit soybean trypsin, which is a serine protease enzyme.

A synthetic peptide for use as a blocking control in assays to test for specificity of RPUSD2 antibody, catalog no. 70R-1460

Peptide H-ISVYYNEASSHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ISVYYNEASSHK^-OH include the following: Data-independent acquisition mass spectrometry to quantify protein levels in FFPE tumor biopsies for molecular diagnostics YJ Kim, SMM Sweet , JD Egertson - Journal of proteome , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.8b00699

Taxol F is an antineoplastic product, which is derived both from natural sources and through synthetic production processes. Taxol, also known as paclitaxel, was originally extracted from the bark of the Pacific yew tree (Taxus brevifolia). However, due to the demand and sustainability concerns, it is now also produced through semi-synthetic methods involving precursor compounds extracted from renewable sources such as the European yew. The mode of action of Taxol F involves stabilizing microtubules, inhibiting their disassembly. This leads to the arrest of mitosis in the G2/M phase of the cell cycle, effectively preventing cell division. This mechanism is particularly useful in halting the proliferation of cancer cells, which are typically characterized by uncontrolled division. Taxol F is predominantly used in cancer treatment, specifically for ovarian, breast, and non-small cell lung cancers, as well as Kaposi's sarcoma. Its efficacy in these applications is attributed to its microtubule-stabilizing properties, which disrupt the cellular division process vital to cancer cell maturation and replication.

Mouse monoclonal SQSTM1 antibody

ADAM10 is a protease that regulates the cell-surface expression of other proteins. ADAM10 cleaves the extracellular domain of membrane-bound proteins and releases them into the extracellular space. This protein has been shown to be important in the progression of Alzheimer's disease by regulating the processing of amyloid precursor protein (APP). ADAM10 is also expressed at the cell surface, where it may function as an enzyme responsible for cleaving glycerol from lipids. The human form of this protein has a molecular mass of 27 kDa and an extracellular domain with a length of 217 amino acids, with n-terminal sequence that starts at position 1. ADAM10 is soluble and consists of two domains: an N-terminal domain and a C-terminal domain.

Mouse monoclonal LENG1 antibody

Rabbit polyclonal RBBP4 antibody

Purified recombinant DGCR6L protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A4 antibody, catalog no. 70R-1794

Affinity purified Rabbit polyclonal SNSR antibody

L-Lysine Monohydrochloride (Ph. Eur., USP) pure

H-IDPYLSPCT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IDPYLSPCT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IDPYLSPCT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IDPYLSPCT-OH at the technical inquiry form on this page

Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.

Rabbit polyclonal PR antibody

Ac-GLAGGSAQSQRAPDRC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-GLAGGSAQSQRAPDRC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-GLAGGSAQSQRAPDRC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-GLAGGSAQSQRAPDRC-NH2 at the technical inquiry form on this page

ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen

Amyloid β (1-40) is a peptide that belongs to the group of amyloid proteins. It has been shown to decrease the activity of ion channels and receptors, as well as inhibit ligand binding to these receptors. Amyloid β (1-40) has also been shown to interact with other proteins by binding to them and inhibiting their function. Amyloid β (1-40) is used in research for pharmacology, cell biology, and neuroscience studies. It is purified from natural sources or synthesized in a laboratory, which yields high purity. The CAS number for this product is 43981-14-2.

URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR

A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP4 antibody, catalog no. 70R-6704

WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Rabbit polyclonal IFN gamma antibody (FITC)

CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.

rrAPO-J

Purified recombinant Human Acidic Fibroblast Growth Factor

HMGB1 antibody was raised in mouse using recombinant human HMGB1 (1-215aa) purified from Trichoplusia ni insect cells as the immunogen.

BI 689648 is an amide drug that has been shown to be effective in treating hypertension in nonhuman primates. It is structurally similar to angiotensin II and blocks the binding of angiotensin II to its receptor, the mineralocorticoid receptor. This binding prevents the activation of the receptor and therefore reduces blood pressure. BI 689648 has a number of other effects, including inducing vasodilatation and inhibiting salt reabsorption, as well as blocking the production of aldosterone, which can lead to sodium loss. BI 689648 also binds to and inhibits mineralocorticoid receptors in cardiovascular tissue, which may help prevent cardiovascular diseases.

CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogen

MPND antibody was raised in rabbit using the middle region of MPND as the immunogen

This antibody reacts with heavy chains on human IgG (gamma chain).

Purified recombinant SLAMF6 protein

Mouse monoclonal SERPINB2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TIPIN antibody, catalog no. 70R-8948

Purified Native Chlamydia trachomatis protein

Please enquire for more information about Nicur including the price, delivery time and more detailed product information at the technical inquiry form on this page

MA 2029 is a novel, potent and selective inhibitor of the enzyme N-type calcium channels. The compound is a molecule that has been shown to have an inhibitory effect on gastrointestinal motility in animals. MA 2029 is orally active and has a safety profile in humans. It also antagonizes muscle contraction and relaxes the cardiovascular system.

Purified Polyclonal NQO1 antibody

INPP5B antibody was raised using the middle region of INPP5B corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

49-162 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAV QGPEETVTQD CLQLIADSET PTIQKGSYTF VPWLLSFKRG SALEEKENKI LVKETGYFFI YGQVLYTDKT YAMGHLIQRK KVHVFGDELS LVTLFRCIQN MPETLPNNSC YSAGIAKLEE GDELQLAIPR ENAQISLDGD VTFFGALKLL

The CD133 antibody is a monoclonal antibody that has neutralizing properties. It targets the CD133 protein, which is found on the surface of various cell types including adipocytes and endothelial cells. The CD133 antibody inhibits the activity of phosphatase, an enzyme involved in cellular signaling pathways. By blocking phosphatase activity, the CD133 antibody can modulate cell growth and differentiation. In addition to its neutralizing effects, the CD133 antibody has been shown to have other biological activities. It can induce caspase-9 activation, leading to apoptosis in certain cell types. This makes it a valuable tool for researchers studying programmed cell death. The CD133 antibody is widely used in life sciences research, particularly in studies related to stem cells and cancer biology. It has been used to identify and isolate specific cell populations, such as stem cells with high regenerative potential. Furthermore, the CD133 antibody can be used in diagnostic applications to detect autoantibodies or as a tool

A synthetic peptide for use as a blocking control in assays to test for specificity of ASCC2 antibody, catalog no. 70R-3373

Human sequence expressed in E. coli Cells; purity >95% by SDS Page and HPLC.

80nm Selenium Nanoparticles (SeNP)

Oropouche virus (OROV) is an arthropod-borne orthobunyavirus found in South America, originally isolated in Trinidad and Tobago. The virus is transmitted by Culicoides paraensis mosquitoes, which feed on vertebrate hosts, including humans. It causes Oropouche fever, a febrile infection similar to dengue. The nucleocapsid protein (N) is encoded by OROV’s small genome segment. It plays a crucial role in genome encapsidation, protecting viral RNA from degradation, as well as facilitating viral RNA synthesis and viral particle assembly. Detecting OROV in diagnostic assays is vital due to its potential to cause large epidemics. This mouse monoclonal antibody for detection of full length Oropouche virus nucleocapsid protein.Cymit Quimica's mouse monoclonal antibodies to Oropouche Virus Nucleoprotein were raised using recombinant Oropouche protein, strain TRVL9760, as immunogen. We offer five different clones allowing customers the flexibility to mix and match to determine the optimum co-operative pair for detection of Oropouche nucleoprotein in their assay system.

KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of FUT6 antibody, catalog no. 70R-5379

Peptide H-IVTDLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IVTDLTK^-OH include the following: Pilose antler polypeptides enhance chemotherapy effects in triple-negative breast cancer by activating the adaptive immune system M Li , Q Li, H Dong, S Zhao, J Ning, X Bai, X Yue - International Journal of , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0141813022022863

Please enquire for more information about 2-Amino nevirapine-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SNAI1 antibody, catalog no. 70R-7981

NPFF2 antibody was raised in rabbit using human NPFF2 protein as the immunogen.

H-PSSTDRSPY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PSSTDRSPY-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PSSTDRSPY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PSSTDRSPY-OH at the technical inquiry form on this page

H-LPIQKETWEAWWTEY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPIQKETWEAWWTEY-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPIQKETWEAWWTEY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPIQKETWEAWWTEY-OH at the technical inquiry form on this page

WNT3A antibody was raised using the N terminal of WNT3A corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

hCG beta protein is an activated protein that plays a crucial role in various biological processes. It has been shown to induce the production of interleukin-6 (IL-6) in human serum, which is important for immune responses and inflammation regulation. In Life Sciences, hCG beta protein is used as a target antigen in DNA vaccine development and collagen research. Specific antibodies against hCG beta protein can be used for ultrasensitive detection in diagnostic assays. Additionally, hCG beta protein can be immobilized on a carbon electrode to enhance the sensitivity of electrochemical biosensors. This versatile protein is also used as a reference standard for the quantification of other proteins, such as alpha-fetoprotein. With its wide range of applications, hCG beta protein is an essential tool for researchers working with Native Proteins & Antigens, DNA aptamers, and monoclonal antibodies.

2,4-Dinitrophenyl 2,3,4,6-tetra-O-acetyl-?-D-glucopyranoside

A synthetic peptide for use as a blocking control in assays to test for specificity of GALK1 antibody, catalog no. 70R-10394

A synthetic peptide for use as a blocking control in assays to test for specificity of PTX3 antibody, catalog no. 70R-5923

INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9401

Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.

Rabbit polyclonal WIPF2 antibody

Please enquire for more information about 15(R)-Pinane thromboxane A2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Alternariol monomethyl ether

Candida Albicans IgA Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Candida Albicans IgA Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Rabbit polyclonal CCBP2 antibody