Biochemicals and Reagents

BCL3 antibody was raised in mouse using recombinant Human B-Cell Cll/Lymphoma 3 (Bcl3)

?-D-Gal-PEG4-azide tetraacetate

ELISA kit for detection of Rat Cystatin C in the research laboratory

Catalogue peptide; min. 95% purity

Mouse monoclonal HLAE antibody (PE)

CRNKL1 antibody was raised in mouse using recombinant Human Crn, Crooked Neck-Like 1 (Drosophila) (Crnkl1)

Purified recombinant Mouse FIt3 Ligand protein

A synthetic peptide for use as a blocking control in assays to test for specificity of RAI14 antibody, catalog no. 70R-4242

Donkey anti Goat IgG (H + L) secondary antibody (Fab'2) with AF594 photostable fluorescent dye label.

Clopidogrel is a prodrug that must be activated by the enzyme CYP2C19 to become its active form, clopidogrel. It is a platelet inhibitor used as an anti-platelet agent and diagnostic tool. Clopidogrel inhibits the action of adenosine diphosphate (ADP) on the P2Y12 receptor and is also a potent pump inhibitor. The major route of metabolism of clopidogrel is through CYP2C19, although other routes such as enteric are present. Inhibitors of this enzyme can affect clopidogrel's effectiveness. Clopidogrel has been shown to be effective in preventing cancer and tumours in rodents, but not humans. It has been found to inhibit cell proliferation in human epithelial cancers when applied orally or topically.

Troponin I antibody is a monoclonal antibody used in Life Sciences research. It specifically targets troponin I, a protein involved in muscle contraction. This antibody can be used to study the role of troponin I in various biological processes, such as cell signaling and muscle development. Additionally, it has been shown to have binding affinity towards vasoactive intestinal peptide (VIP) and collagen, making it a versatile tool for studying these molecules as well. The high specificity and affinity of this antibody make it an ideal choice for experiments requiring detection and quantification of troponin I or related proteins in samples such as human serum or tissue lysates.

H-EHERYHSNWRAMASE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EHERYHSNWRAMASE-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EHERYHSNWRAMASE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EHERYHSNWRAMASE-OH at the technical inquiry form on this page

Applications Cholesteryl stearate

Ethylmethylcarbamic chloride

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of CRYBA1 antibody, catalog no. 70R-2029

Slc12a5 antibody was raised in rabbit using the N terminal of Slc12a5 as the immunogen

NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Rabbit polyclonal TMED2 antibody

Mouse monoclonal LCMT1 antibody

Erythropoietin-alpha protein containing 165 amino acids.

Cerium(III) bromide hydrate is a halide compound that has various applications in the field of medicine and research. It is commonly used as a photomultiplier material, which is essential for detecting and amplifying light signals. Additionally, it serves as a reagent in chemical reactions and plays a role in collagen synthesis. Cerium(III) bromide hydrate has been found to have peroxisome-stimulating properties, promoting the production of sesquiterpenes such as β-caryophyllene. This compound has also shown potential in cavity research and can be used as an electrode material. In the medical field, Cerium(III) bromide hydrate has been studied for its effects on pancreatitis and its interaction with human C-C chemokine receptors. Its unique molecular sequences make it a valuable compound for various scientific investigations.

A synthetic peptide for use as a blocking control in assays to test for specificity of STK32A antibody, catalog no. 70R-3604

Alpha-2-Macroglobulin, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Alpha-2-Macroglobulin, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.

roLeptin qA

A synthetic peptide for use as a blocking control in assays to test for specificity of CPB2 antibody, catalog no. 70R-5364

Chlamydia trachomatis antibody (FITC) was raised in Mouse using LPS as the immunogen.

Purified recombinant Human FRZB protein (His tag)

Rabbit polyclonal DRAP1 antibody (biotin)

Affinity purified Rabbit polyclonal PIK3R1 antibody

Mouse anti-human IgG is a monoclonal antibody used in Life Sciences research. It has the ability to lyse cells, making it useful for various applications such as immunoprecipitation and flow cytometry. This antibody specifically targets human IgG, allowing for the detection and quantification of IgG molecules in biological samples. In addition, Mouse anti-human IgG has been shown to neutralize the activity of growth factors such as oncostatin, TGF-alpha, and epidermal growth factor. It also inhibits the expression of E-cadherin, a protein involved in cell adhesion and migration. With its versatility and specificity, Mouse anti-human IgG is an essential tool for researchers studying various aspects of cell biology and immune response.

Purified recombinant Lin28B protein (His tag)

LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Pancoprida is a bioactive peptide, which is a synthetic compound derived from rational peptide design and combinatorial chemistry techniques. It functions through the modulation of specific receptor pathways, primarily targeting neuronal and inflammatory processes. Pancoprida exhibits high affinity for serotonin receptors, influencing neurotransmitter release and uptake, and also modulates certain cytokine pathways, thereby reducing inflammation. This compound is utilized in preclinical models to explore its potential therapeutic applications in neurodegenerative diseases and inflammatory disorders. Research is ongoing to evaluate its efficacy and safety profile. Pancoprida's action on serotonin receptors also opens avenues for investigating its role in managing psychiatric conditions such as depression and anxiety. Scientists are particularly interested in its ability to cross the blood-brain barrier, a crucial property for central nervous system-targeted therapies. Current studies focus on refining its delivery methods and understanding its long-term impact on systemic physiological processes.

Daidzein diglucuronide is a glucuronide metabolite of daidzein, which is a natural product. It has shown anticancer activity in vitro and in vivo. Daidzein diglucuronide binds to the enzyme carboxylesterase and inhibits its activity, leading to an increase in the levels of carboxylic acids in the blood. These metabolites are then excreted through urine and bile. Daidzein diglucuronide may also be used as an anti-inflammatory agent due to its ability to inhibit prostaglandin synthesis.

Peptide H-IPLENLQIIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IPLENLQIIR-OH include the following: Data-independent acquisition mass spectrometry to quantify protein levels in FFPE tumor biopsies for molecular diagnostics YJ Kim, SMM Sweet , JD Egertson - Journal of proteome , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.8b00699 Selected reaction monitoring (SRM) analysis of epidermal growth factor receptor (EGFR) in formalin fixed tumor tissue T Hembrough, S Thyparambil, WL Liao, MM Darfler - Clinical proteomics, 2012 - Springerhttps://link.springer.com/article/10.1186/1559-0275-9-5 Label-free quantitation of protein modifications by pseudo selected reaction monitoring with internal reference peptides SD Sherrod , MV Myers, M Li, JS Myers - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr201240a The addition of FAIMS increases targeted proteomics sensitivity from FFPE tumor biopsies S Sweet , D Chain, W Yu, P Martin, M Rebelatto - Scientific Reports, 2022 - nature.comhttps://www.nature.com/articles/s41598-022-16358-1 High-Field Asymmetric Waveform Ion Mobility Spectrometry and Parallel Reaction Monitoring Increases Sensitivity for Clinical Biomarker Quantitation from Formalin S Sweet , D Chain, W Yu, P Martin, M Rebelatto - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.02.08.479554.abstract Regulated Phosphosignaling Associated with Breast Cancer Subtypes and Druggability MM Kinsinger13, H Rodriguez13, MJ Ellis14 - researchgate.nethttps://www.researchgate.net/profile/Mehdi-Mesri/publication/333769448_Regulated_Phosphosignaling_Associated_with_Breast_Cancer_Subtypes_and_Druggability/links/5d3fcca1a6fdcc370a6bce53/Regulated-Phosphosignaling-Associated-with-Breast-Cancer-Subtypes-and-Druggability.pdf Comparative evaluation of strategies for quantifying signaling pathway proteins in Ewing sarcoma MA Applebaum, DG Thomas - Applied , 2014 - journals.lww.comhttps://journals.lww.com/appliedimmunohist/fulltext/2014/09000/Comparative_Evaluation_of_Strategies_for.6.aspx Characterization of MGMT and EGFR protein expression in glioblastoma and association with survival LR Schaff , D Yan, S Thyparambil, Y Tian - Journal of Neuro , 2020 - Springerhttps://link.springer.com/article/10.1007/s11060-019-03358-x Odin (ANKS1A) modulates EGF receptor recycling and stability J Tong, Y Sydorskyy, JR St-Germain, P Taylor - PloS one, 2013 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0064817 Proteomic analysis of the EGFR interactome and post-translational modifications associated with receptor endocytosis in response to EGF and stress J Tong, P Taylor, MF Moran - Mol Cell Proteomics, 2014 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=5da23653879cecf03e12b96fa0a33eba747a6dc4 Efficient microscale basic reverse phase peptide fractionation for global and targeted proteomics HJ Lee , HJ Kim, DC Liebler - Journal of proteome research, 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.6b00102 CD166-mediated epidermal growth factor receptor phosphorylation promotes the growth of oral squamous cell carcinoma G Jia, X Wang, M Yan, W Chen, P Zhang - Oral Oncology, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1368837516300562

KLH antibody was raised in mouse using KLH as the immunogen.

Goat polyclonal Prealbumin antibody (Nephelometric and Turbidimetric grade)

H-LAAYLFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAAYLFT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAAYLFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAAYLFT-OH at the technical inquiry form on this page

m-PEG6-acid

Myelin Oligodendrocyte Glycoprotein

Undecanoic acid is used as an unsaturated fatty acid. It is also used as intermediates of Liquid Crystals. It is used in organic synthesis, Catalytic agent, Petrochemical additive. It is also used in anti-fungal agent, perfumery chemicals. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Rabbit polyclonal PLB antibody

Mouse monoclonal Troponin I antibody

Purified Polyclonal Caspase 2 p18 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH4A1 antibody, catalog no. 70R-1105

Lipase protein is a collagen-based protein that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences as a native protein and antigen for research purposes. Lipase protein is involved in the breakdown and metabolism of lipids, particularly triglycerides. It acts as an enzyme to catalyze the hydrolysis of lipoprotein lipase, which helps in the absorption and utilization of dietary fats by adipose tissues. Additionally, lipase protein has been found to have natriuretic properties, meaning it promotes the excretion of sodium through urine. This protein also exhibits cytotoxic effects on certain types of cells and has been explored as a potential target for multidrug resistance reversal in cancer therapy. With its neutralizing capabilities, lipase protein can be utilized to counteract the activity of specific toxins or pathogens. Researchers often rely on monoclonal antibodies against lipase protein to study its structure and function in detail. Overall, lipase protein is an

Armenian Hamster monoclonal CD27 antibody (PE)

KLHL22 antibody was raised in Mouse using a purified recombinant fragment of human KLHL22 expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal COUP TF1 antibody

Purified recombinant Human CD2 protein (His tag)

BIIL260 is a cell-permeant, highly potent and selective inhibitor of ion channels. It has been shown to inhibit the activity of several ion channels, including nicotinic acetylcholine receptor (nAChR), alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor (AMPAR), and 5HT3 receptor. BIIL260 is a ligand that binds to receptors on the surface of cells in order to initiate a change in their shape or activity. This protein is used as research tool in Cell Biology, Pharmacology, and other life science fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of CASP8AP2 antibody, catalog no. 70R-8932

NEIL1 antibody was raised in Rabbit using Human NEIL1 as the immunogen

BRK tyrosine kinase (PTK6) inhibitor; anti-proliferative in breast cancer cells

DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW

Purified recombinant RGS4 protein

Factor IX antibody was raised in mouse using human factor IX as the immunogen.

Peptide Bax-BH3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Bax-BH3 include the following: Development of Novel Peptides to Study Protein-Protein Interactions MJK Vince - 2022 - rave.ohiolink.eduhttps://rave.ohiolink.edu/etdc/view?acc_num=ohiou1650624370145671 Bax-derived membrane-active peptides act as potent and direct inducers of apoptosis in cancer cells JG Valero , L Sancey , J Kucharczak - Journal of cell , 2011 - journals.biologists.comhttps://journals.biologists.com/jcs/article-abstract/124/4/556/32058 Screening efficient BH3-mimetics to hBcl-B by means of peptidodynmimetic method D Sivakumar , B Gorai , T Sivaraman - Molecular BioSystems, 2013 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2012/mb/c2mb25195g Role of single disulfide linkages in the folding and activity of scyllatoxin-based BH3 domain mimetics D Arachchige , M Margaret Harris - Journal of Peptide , 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2999 Domain-specific insight into the recognition of BH3-death motifs by the pro-survival Bcl-2 protein AU Mushtaq , J aca
den, K Ali, G Gröbner - Biophysical Journal, 2022 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(22)00895-5.pdf

LISA-101 is a peptide that can be used as a research tool for the study of receptor activation and ligand binding. LISA-101 is an inhibitor of ion channels, which are proteins that allow electrically charged particles to move in and out of cells. LISA-101 binds to receptors on the surface of cells and blocks ion channels from opening. This prevents the flow of ions across the membrane, which blocks nerve impulses, leading to a decrease in pain sensation. LISA-101 has been shown to inhibit voltage-gated sodium channels and calcium channels, both which are involved in pain perception. LISA-101 is a high purity reagent with CAS number 1638785-74-6. It has been produced by recombinant technology without any animal or human testing.br>br> LISA-101 is a potent pharmacology research tool that inhibits ion channel activity by binding to its receptor. This inhibition leads to decreased pain sensations as it prevents nerve

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

t-Boc-N-amido-PEG12-acid

Rabbit polyclonal ARPC2 antibody (HRP)

Affinity purified Rabbit polyclonal PSKH1 antibody

Rabbit polyclonal CLK4 antibody

Purified Rabbit polyclonal B3GALT4 antibody

MAP2K4 antibody was raised in Mouse using a purified recombinant fragment of MAP2K4 expressed in E. coli as the immunogen.

Peptide H-AQAVHPGYGFLSENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AQAVHPGYGFLSENK-OH include the following: Dual mRNA therapy restores metabolic function in long-term studies in mice with propionic acidemia L Jiang, JS Park, L Yin, R Laureano - Nature , 2020 - nature.comhttps://www.nature.com/articles/s41467-020-19156-3

CD244 antibody was raised in rabbit using the C terminal of CD244 as the immunogen

Peptide H-MIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MIV-OH include the following: Detecting antimicrobial peptides by exploring the mutual information of their sequences V Tripathi , P Tripathi - Journal of Biomolecular Structure and , 2020 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2019.1695667 Accumulation of Peptides by Mycobacillin-negative Mutants of Bacillus subtilis B3 S MAJUMDER, SK GHOSH - , 1985 - microbiologyresearch.orghttps://www.microbiologyresearch.org/content/journal/micro/10.1099/00221287-131-1-119 DNA priming prior to inactivated influenza A (H5N1) vaccination expands the antibody epitope repertoire and increases affinity maturation in a boost-interval S Khurana, J Wu , M Dimitrova, LR King - The Journal of , 2013 - academic.oup.comhttps://academic.oup.com/jid/article-abstract/208/3/413/2192617 High-affinity small-molecule inhibitors of the menin-mixed lineage leukemia (MLL) interaction closely mimic a natural protein-protein interaction S He , TJ Senter, J Pollock, C Han - Journal of medicinal , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm401868d Effect of a water-miscible organic solvent on the kinetic and structural properties of trypsin RM Guinn, HW Blanch , DS Clark - Enzyme and microbial technology, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/014102299190151Y Comparison of mitochondrially synthesized polypeptides of human, mouse, and monkey cell lines by a two-dimensional protease gel system N Oliver, J McCarthy, DC Wallace - Somatic cell and molecular genetics, 1984 - Springerhttps://link.springer.com/article/10.1007/BF01535230 Cloning and expression of the human N-methyl-D-aspartate receptor subunit NR3A M Eriksson, A Nilsson, S Froelich-Fabre, E aca
kesson - Neuroscience , 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304394001025241 Molecular evidence for antigen-driven immune responses in cardiac lesions of rheumatic heart disease patients L Guilherme , N Dulphy , C Douay - International , 2000 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/12/7/1063/661501 Heterosubtypic influenza protection elicited by double-layered polypeptide nanoparticles in mice L Deng, TZ Chang , Y Wang , S Li - Proceedings of the , 2018 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1805713115 Synthetic peptides homologous to human glycophorins of the KK Johe, V Vengelen-Tyler, R Leger, OO Blumenfeld - 2011 - researchgate.nethttps://www.researchgate.net/profile/Olga-Blumenfeld/publication/21436281_Synthetic_peptides_homologous_to_human_glycophorins_of_the_Miltenberger_complex_of_variants_of_MNSs_blood_group_system_specify_the_epitopes_for_Hil_SJL_Hop_and_Mur_antisera/links/0c96052ce1e4cbb445000000/Synthetic-peptides-homologous-to-human-glycophorins-of-the-Miltenberger-complex-of-variants-of-MNSs-blood-group-system-specify-the-epitopes-for-Hil-SJL-Hop-and-Mur-antisera.pdf Synthetic peptides homologous to human glycophorins of the Miltenberger complex of variants of MNSs blood group system specify the epitopes for Hil, SJL, Hop, and KK Johe, V Vengelen-Tyler, R Leger, OO Blumenfeld - 1991 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/78/9/2456/173263 Effects of mixed-ligand complex formation on deprotonation of amide groups in acid amides and peptides I Sovago , B Harman, A Gergely - Journal of the Chemical , 1986 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/1986/dt/dt9860000235 Proteins of two strains of mosquito iridescent virus GW Wagner, JD Paschke, WR Campbell, SR Webb - Intervirology, 1974 - karger.comhttps://karger.com/int/article-abstract/3/1-2/97/176881 chemistry zyxwvutsrqponmlkj D Papahadjopoulos, RM Straubinger , K Hong - Surf. Sci, 1986 - academia.eduhttps://www.academia.edu/download/85086892/bi00449a03420220428-1-1361g2c.pdf Proteolytic fragments of the nicotinic acetylcholine receptor identified by mass spectrometry: implications for receptor topography CR Moore, JR Yates III , PR Griffin , J Shabanowitz - Biochemistry, 1989 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/bi00449a034 Identification of recombination events resulting in three hybrid genes encoding human MiV, MiV (JL), and Sta glycophorins CH Huang, OO Blumenfeld - 1991 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/77/8/1813/168573 Anti-EnaFS detected in the serum of an MiVII homozygote B Laird-Fryer, JJ Moulds, W Dahr, YO Min - , 1986 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1046/j.1537-2995.1986.26186124031.x

Purified Rabbit polyclonal CHST2 antibody

Rabbit polyclonal GFI1b antibody

Fibrinogen Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Fibrinogen Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

It finds it uses in a wide range of fragrances, especially in fine fragrances and soaps, in floral, rose petal or herbal fragrances. 9-Decen-1-ol is used in the preparation of semifluorinated acids required for the synthesis of poly(styrene-b-semi fluorinated isoprene) block copolymers with -CF2H-terminated side groups. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal TNF alpha antibody (PE)

Purified recombinant KCTD5 protein

Clopidogrel is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma. Clopidogrel is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Hepronicate is a polyunsaturated fatty acid that is a precursor to prostaglandin E1. It is available as a prescription drug and is used for the treatment of symptoms caused by congestive heart failure, diabetic neuropathy, and corneal endothelial cell dysfunction. Hepronicate has also been shown to stimulate the growth of cells in culture and may be an effective treatment for many types of cancer. This drug binds to the polyunsaturated fatty acid receptor on the surface of cells, which leads to an increase in polyunsaturated fatty acids in the cell membrane and activation of protein kinase C. Hepronicate may also inhibit tumor growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication.

Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).

Rabbit polyclonal MPZ antibody (HRP)

Rabbit polyclonal PPP3CC antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CAMLG antibody, catalog no. 70R-2352

A synthetic peptide for use as a blocking control in assays to test for specificity of FUCA1 antibody, catalog no. 70R-5428

SB-peptide offers the scrambled version of OVA 257-264. FILKSINE can be used as a negative control of OVA 257-264 studies. SB-peptide offers also OVA 257-264 (see section OVA 257-264). Ovalbumin protein: OVA 257-264 (H-2Kb) is an epitope of interest of the egg white albumen, ovalbumin. Ovalbumin is a glycoprotein that is sufficiently large and complex to be mildly immunogenic. Indeed, it has been demonstrated that Ovalbumin contains B-cell epitopes which are recognized by specific IgE antibodies and CD4 T cell epitopes restricted by the MHC I-Ad molecule in mice and by HLA-D molecule in human. Applications of OVA 257-264: OVA 257-264 is used to stimulate T cells in PBMCs and to quantify peptide epitope specificity and IFN-γ releasing effector cells by ELISPOT assay. OVA 257-264 is also used to test new adjuvant in immunotherapeutic vaccine development. OVA 257-264 can form a stable hydrogel and stimulate a immune response. This reaction seems to be linked with OVA 257-264 property to self-assemble into a hydrogel. Sequence:C45H74N10013

Mouse monoclonal SH2B3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS52 antibody, catalog no. 70R-3819

H-WDNFQGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WDNFQGK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WDNFQGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WDNFQGK-OH at the technical inquiry form on this page

Mouse monoclonal CRYAB antibody

Rabbit polyclonal IL12B antibody

Mouse monoclonal RBM46 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DHX16 antibody, catalog no. 70R-5647

Please enquire for more information about (Ile76)-TNF-a (70-80) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF12 antibody, catalog no. 70R-8895

Dibromochloroacetamide is a peptide that is used as a research tool to study the interactions of peptides with receptors and ion channels. It is an inhibitor of these protein interactions, which can be applied in pharmacology. Dibromochloroacetamide also has been shown to act as an agonist for the histamine receptor and can inhibit the activity of acetylcholinesterase enzyme, which is important for the regulation of nerve impulse transmission. Dibromochloroacetamide binds to specific sites on proteins and alters their function. This inhibition can be reversed by adding excess amounts of substrate (histamine) or by washing away unbound Dibromochloroacetamide from the protein surface.

A synthetic peptide for use as a blocking control in assays to test for specificity of RALY antibody, catalog no. 70R-1338

Peptide H-ASQDVNTAVAWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ASQDVNTAVAWYQQKPGK^-OH include the following: Improving the quality of a therapeutic antibody by continuous manufacturing T Geuens, E Wouters, S Bashir, A Van Nuland - simabs.comhttps://www.simabs.com/wp-content/uploads/2023/03/White-Paper-on-drug-substance-characterisation_fin.pdf Development of a Mass Spectrometric Method for Pharmacokinetic Study of Trastuzumab. NY Hong, JN Choi, JW Kang - Bulletin of the Korean , 2014 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=02532964&asa=N&AN=108749106&h=JigGeN3z9GvSZsJ%2Bz5VbmSWUlLfuQMcq1RrTTRQZgQ%2F0EPKbTA1LNfrYU%2FaEKqsnirMDtraNK5nMJu4tIKCNBQ%3D%3D&crl=c Strategies for the Characterisation of Biopharmaceuticals K Sandra , M Joseph - labmate-online.comhttps://www.labmate-online.com/article/bioanalytical/40/agilent-technologies/strategies-for-the-characterisation-of-biopharmaceuticals/1913 The Power of Liquid Chromatography-Mass Spectrometry in the Characterization of Protein Biopharmaceuticals I Vandenheede, K Sandra , P Sandra - 2013 - chromatographyonline.comhttps://www.chromatographyonline.com/view/power-liquid-chromatography-mass-spectrometry-characterization-protein-biopharmaceuticals Comparative study of trastuzumab modification analysis using mono/multi-epitope affinity technology with LC-QTOF-MS C Zuo, J Zhou, S Bian , Q Zhang, Y Lei, Y Shen - Journal of , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2095177924001126

Human sequence expressed in E. coli Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

Please enquire for more information about Smad1, gst tagged human including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-ALHGGWTTK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALHGGWTTK-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALHGGWTTK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALHGGWTTK-OH at the technical inquiry form on this page

WIN 64338 hydrochloride is a bradykinin receptor antagonist that inhibits the action of bradykinin, an inflammatory and pain-causing agent.  It also blocks the binding of bradykinin to its receptors, thereby preventing their activation which causes inflammation and pain.  The affinity values for WIN 64338 hydrochloride at the bradykinin B2 receptor are more than 1000 times greater than those at the bradykinin B1 receptor.

Histone H3  (tri methyl K9) Monoclonal Antibody

Hepatitis A virus antibody was raised in mouse using purified hepatitis A as the immunogen.

Mouse monoclonal BHMT antibody

Purified native Human alpha 2 Antiplasmin protein

Recombinant Mouse LXN protein with His tag

Rabbit polyclonal FEN1 antibody

Peptide H-YSFTIELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSFTIELR-OH include the following: Quantitation of thrombin-activatable fibrinolysis inhibitor in human plasma by isotope dilution mass spectrometry JX Wheeler, C Thelwell, P Rigsby, G Whiting - Analytical Biochemistry, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269721003146

Please enquire for more information about Testosterone antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Positive allosteric modulator of the metabotropic glutamate receptor mGluR5 with EC50 in submicromolar range. The compound is able to increase mGluR5 function in vitro and in vivo. A study showed that ADX-47273 enhanced fear extinction learning as well as improved reversal learning in experimental animals.

D-Fructose

Purified recombinant Human DSTN Protein (His tag)

HBsAg-ad, Ultra Pure is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBsAg-ad, Ultra Pure including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Rabbit polyclonal TRXR2 antibody

Rabbit polyclonal TNFAIP8 antibody

FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.

ASCC2 antibody was raised in Rabbit using Human ASCC2 as the immunogen

Rabbit polyclonal WDR4 antibody

Mouse monoclonal FGF2 antibody

DARKtide is a substrate peptide for death-associated protein kinase (DAPK) for use in kinases assays. DAPK is involved in several cellular pathways including: apoptosis, tumour suppression, stress response, anti-viral immunity and IL-1-associated inflammatory diseases. In C. elegans DAPK-1 regulates epidermal morphogenesis, innate immunity and wound repair.

TC-G 1005 is a drug that inhibits the uptake of acetylcholine in the lung. TC-G 1005 is a potent and selective inhibitor of taurocholate co-transporting polypeptide (TCCP), which is responsible for transporting bile acids into the liver. TC-G 1005 has been shown to reduce weight gain and fat deposits in mice, as well as to increase insulin sensitivity in adipose tissue. TC-G 1005 has also been shown to have positive effects on muscle function, reversing constrictions that are caused by cholinergic agents. TC-G 1005 also has anti-inflammatory properties, which may be due to its ability to inhibit the uptake of acetylcholine in bronchial passages.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC645015 antibody, catalog no. 70R-2855

Mouse sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL4 antibody, catalog no. 70R-8342

Iprodione-d5 is a medicinal analog of Iprodione, a kinase inhibitor used in cancer treatment. It has been shown to induce apoptosis in cancer cells by inhibiting kinases that are crucial for tumor growth and survival. This compound has been tested in Chinese hamster ovary cells and human cancer cell lines, demonstrating potent anticancer activity. Iprodione-d5 is excreted primarily through urine, making it a viable option for systemic delivery. Its potential as an anticancer agent makes it a promising area of research for the development of new protein kinase inhibitors.

Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Mouse monoclonal SNTA1 antibody

H-CGGKTGASKRGARGIVALLG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGKTGASKRGARGIVALLG-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGKTGASKRGARGIVALLG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGKTGASKRGARGIVALLG-OH at the technical inquiry form on this page