Biochemicals and Reagents

PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG

Purified native Human Human Growth Hormone (> 95% pure)

Mouse monoclonal NUDT6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ATIC antibody, catalog no. 70R-1295

Conjugated Triiodothyronine-HRP hapten

Malotilate is a pharmacological agent that is used to treat symptoms of hepatitis, bowel disease, and collagen diseases. This drug reduces collagen synthesis and cell migration activity of fibroblasts in vitro. It also has been shown to facilitate liver regeneration in rats. Malotilate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

MIF antibody was raised in mouse using recombinant human MIF (1-114 aa) purified from E. coli as the immunogen.

TAAR5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Inhibitor of tyrosinase in melanocytes: skin whitener

A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA5 antibody, catalog no. 70R-1126

The IGFBP4 antibody is a monoclonal antibody that specifically targets and binds to insulin-like growth factor-binding protein 4 (IGFBP4). This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas. One of the key characteristics of the IGFBP4 antibody is its ability to inhibit the activity of IGFBP4, a protein involved in regulating the actions of insulin-like growth factors (IGFs). By binding to IGFBP4, this antibody prevents it from interacting with IGFs, thereby modulating their signaling pathways and biological activities. Furthermore, the IGFBP4 antibody has been found to have potential therapeutic applications. It has been shown to exhibit anti-beta amyloid properties, which may be beneficial in the treatment of neurodegenerative disorders such as Alzheimer's disease. Additionally, this antibody has been investigated for its potential role in targeting steroid receptors and modulating hormone-related processes. The versatility of the IG

Peptide H-EAMEHPYFYTVVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAMEHPYFYTVVK-OH include the following: Extracellular protein kinase CK2 is a novel associating protein of neuropilin-1 Y Shintani, S Takashima, H Kato, K Komamura - Biochemical and , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X09010717 expression of receptors for advanced glycation end products in human endothelial cells. M Fujita, H Okuda, O Tsukamoto, Y Asano, YL Hirata - mhlw-grants.niph.go.jphttps://mhlw-grants.niph.go.jp/system/files/2009/092031/200912011A/200912011A0014.pdf

Clostridium difficile Toxin B protein is a potent protein that plays a crucial role in the pathogenesis of Clostridium difficile infection. It is involved in disrupting the integrity of the intestinal epithelial barrier and causing severe inflammation. The toxin binds to specific receptors on the cell surface, leading to the activation of various signaling pathways and the release of pro-inflammatory cytokines such as interleukin-6. The high purity and quality of our Clostridium difficile Toxin B protein make it an ideal tool for research purposes. It can be used in various applications, including studying the mechanism of action of the toxin, developing diagnostic assays, and screening potential therapeutic agents. Our Clostridium difficile Toxin B protein is expressed in a recombinant system using an expression plasmid. It has been extensively characterized and tested for its biological activity. The protein is supplied in a lyophilized form for ease of storage and transportation. Researchers can use our Clostridium difficile To

H-SIQPENLEYR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIQPENLEYR-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIQPENLEYR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIQPENLEYR-OH at the technical inquiry form on this page

H-GFNFTTQELSSNPPLATIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GFNFTTQELSSNPPLATIL-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GFNFTTQELSSNPPLATIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GFNFTTQELSSNPPLATIL-OH at the technical inquiry form on this page

BAG4 antibody was raised in Rabbit using Human BAG4 as the immunogen

Mouse monoclonal TP53I3 antibody

SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids DSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAE

The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.

Dimethylallyl Pyrophosphate (triammonium salt) is a versatile compound used in various research applications. It acts as a binding protein for dopamine and has been studied for its potential role in the regulation of neurotransmitters. This compound is commonly used in the synthesis of alkaloids, ligases, and channels. Additionally, Dimethylallyl Pyrophosphate (triammonium salt) has shown promise in studies related to erythropoietin production and hypotension management. Researchers have also explored its potential therapeutic effects on depressive disorders and its interactions with other compounds such as taurine, quetiapine, and epoxomicin. With its wide range of applications, Dimethylallyl Pyrophosphate (triammonium salt) is an essential reagent for any laboratory or research facility seeking to advance scientific knowledge.

1-Epi-darunavir is a potent HIV protease inhibitor that blocks the cleavage of polyproteins that are necessary for the assembly and release of new viruses. It is an epimer of darunavir and has been shown to be more potent than its parent compound. 1-Epi-darunavir binds to the active site of HIV protease and prevents the formation of a complex between the enzyme and its substrate, leading to inhibition of HIV replication. This drug also inhibits ion channels, including calcium channels, potassium channels, sodium channels, and chloride channels. 1-Epi-darunavir has been shown to inhibit ligand binding to receptors in cell culture, such as peptides or antibodies.

A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6185

A synthetic peptide for use as a blocking control in assays to test for specificity of MAF antibody, catalog no. 70R-8267

N-Acetyl-L-tyrosine

A synthetic peptide for use as a blocking control in assays to test for specificity of PAOX antibody, catalog no. 70R-2927

GV-58 is a molecule that has been shown to have physiological levels in the brain. GV-58 is an active analog of a neurotransmitter and has been shown to disrupt physiological levels of neurotransmission. GV-58 has also been shown to cause symptoms such as spontaneous activity, disrupted sleep cycles, and spontaneous physical activity. This drug has also been shown to be effective against cancer cells in culture and animal models. More research is needed to determine if this drug is safe for use in humans.

The Keratin 19 antibody is a specific antibody used in Life Sciences for ultrasensitive detection. It can be utilized in various applications such as electrochemical impedance spectroscopy, polymerase chain reaction (PCR), flow immunoassay, and more. This antibody is designed to target Keratin 19, a protein commonly found in epithelial cells. It has been extensively validated and proven to provide accurate and reliable results. The Keratin 19 antibody is highly sensitive and can detect even low levels of Keratin 19 expression. It binds specifically to the target protein, allowing for precise detection and measurement. This antibody can be used in research settings to study the expression of Keratin 19 in different cell types or tissues. In addition to its high sensitivity, this antibody also offers excellent specificity. It does not cross-react with other proteins or interfere with other cellular processes. This ensures that the results obtained are accurate and reliable. The Keratin 19 antibody is easy to use and compatible with various

Recombinant Human AMT protein (His tag)

Peptide H-MMMMMMMMMMMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MMMMMMMMMMMM-OH include the following: T cell repertoire in tuberculosis: selective anergy to an immunodominant epitope of the 38-kDa antigen in patients with active disease HM Vordermeier, DP Harris, G Friscia- European journal of ..., 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830221024

Rabbit polyclonal AMPK beta 1 antibody

Peptide H-AELLVALENQHTIDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AELLVALENQHTIDL-OH include the following: CD47 plays a role as a negative regulator in inducing protective immune responses to vaccination against influenza virus YT Lee, EJ Ko , Y Lee , YN Lee, Z Bian , Y Liu - Journal of , 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.00605-16

Mouse monoclonal EPM2AIP1 antibody

Ethyl 2,3,4,6-tetra-O-acetyl-1-thio-?-D-mannopyranoside

Purified Polyclonal Histone H4 antibody

SP1 antibody was raised in rabbit using the C terminal of SP1 as the immunogen

1-135 amino acids: MACGLVASNL NLKPGECLRV RGEVAPDAKS FVLNLGKDSN NLCLHFNPRF NAHGDANTIV CNSKDGGAWG TEQREAVFPF QPGSVAEVCI TFDQANLTVK LPDGYEFKFP NRLNLEAINY MAADGDFKIK CVAFD

The p47 phox antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the p47 phox protein, which plays a crucial role in the activation of macrophages. This antibody can be used to study the function and regulation of p47 phox in various biological processes. The p47 phox antibody has been shown to be highly specific and sensitive in detecting the presence of p47 phox in samples. It can be used for techniques such as immunohistochemistry, Western blotting, and ELISA. In addition, this antibody has been validated for use with human serum samples, making it a valuable tool for researchers studying diseases or conditions related to macrophage activation. Its ability to recognize specific epitopes on the p47 phox protein ensures accurate and reliable results. Furthermore, the p47 phox antibody has been demonstrated to have minimal cross-reactivity with other proteins or molecules, ensuring that it provides specific and reliable data. Its high affinity

Applications Ligand used for the preparation of an affinity resin highly specific for glucosidase I purification. Glucosidase I is involved in the post-translational processing of N-linked glycoproteins. References HettKamp, H., et al.: Eur. J. Biochem., 142, 85 (1984); Shailubhai, K., et al.: Biochem. J., 247, 555 (1987); Bause, E., et al.: FEBS, 278, 167 (1991)

OXR1 antibody was raised using the N terminal of OXR1 corresponding to a region with amino acids VESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVV

Rabbit Polyclonal eIF2 alpha antibody (Ser51)

FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Influenza A antibody was raised in mouse using Influenza A as the immunogen.

DL-Tyrosine

LJ570 is a multilayer optical system that has been used in the development of vaccines. It provides an effective platform for the translation of research into clinical applications, as it can be applied to infectious diseases, cancer, and other diseases. LJ570 has provided a method for stabilizing proteins and analyzing their sequences. This technology can also be used to develop sensors for detecting cancer cells and stains for identifying bacteria.

A synthetic peptide for use as a blocking control in assays to test for specificity of RHOU antibody, catalog no. 70R-5757

Ecdysterone is an insect steroid hormone that induces apoptosis, cell proliferation, growth by controlling gene expression involved in molting and metamorphosis. And it is also used as a ecdysteroid in both plant and animal species that controls cell death. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified recombinant CXCL5 protein (His tag)

MAP2K4 antibody was raised in Mouse using a purified recombinant fragment of MAP2K4 expressed in E. coli as the immunogen.

CD2 antibody was raised in rat using CD2/LFA-2 as the immunogen.

HAPLN4 antibody was raised in rabbit using the C terminal of HAPLN4 as the immunogen

A potent inhibitor of CETP that inhibits transfer of cholesteryl esters and triglycerides. Raises HDL cholesterol levels whilst lowering LDL cholesterol. Reduces cardiovascular events in patients with atherosclerotic vascular disease that receive statin treatment.

PTHLH Monoclonal Antibody

FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Ac-Asp-Asn-Leu-Asp-MCA is a peptide that is used as an inhibitor of protein interactions. It has been shown to activate the beta2 adrenergic receptor and inhibit the alpha1A and alpha1B receptors. Ac-Asp-Asn-Leu-Asp-MCA can be used in research as a tool to study receptor binding, ion channels, and other proteins. It is also used in antibody production for life science research.

IgG, H&L Chains (Anti-Mouse) Goat Polyclonal Antibody, IgG Fraction is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgG, H&L Chains (Anti-Mouse) Goat Polyclonal Antibody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

2,2-Dimethyl-propanoic acid (1-naphthalenyloxy)methyl ester is a peptide that can be used as an activator or inhibitor of ion channels and ligands. The chemical structure of this molecule is similar to that of the endogenous neuropeptides somatostatin and vasoactive intestinal peptide. This peptide has been shown to inhibit the interaction between proteins and receptors, which may be due to its ability to bind with high affinity to a wide variety of ion channels. It also inhibits protein synthesis by binding to ribosomes.br> br> br>

Rabbit Polyclonal CST2 antibody

CSK antibody was raised in Mouse using a purified recombinant fragment of human CSK expressed in E. coli as the immunogen.

Dihydrotestosterone 3 Conjugate for use in immunoassays

Peptide H-AVDGYVKPQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVDGYVKPQIK^-OH include the following: Identification of isoform-specific dynamics in phosphorylation-dependent STAT5 dimerization by quantitative mass spectrometry and mathematical modeling ME Boehm, L Adlung , M Schilling, S Roth - Journal of proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr5006923 Identification of in vivo protein phosphorylation sites with mass spectrometry J Qin, X Zhang - Posttranslational Modifications of Proteins: Tools for , 2002 - Springerhttps://link.springer.com/protocol/10.1385/1-59259-181-7:211 One-source peptide/phosphopeptide standards for accurate phosphorylation degree determination B Hahn, M Böhm, V Raia, N Zinn , P Möller - , 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000569

Mouse monoclonal RTN4IP1 antibody

Rabbit Polyclonal GSK3 alpha antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB4 antibody, catalog no. 70R-4969

Peptide H-FGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FGF-OH include the following: Identification and characterization of a fibroblast growth factor (FGF) binding domain in the cysteine-rich FGF receptor Z Zhou, ME Zuber, LW Burrus , BB Olwin - Journal of Biological Chemistry, 1997 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)79355-7/abstract Peptides derived from specific interaction sites of the fibroblast growth factor 2-FGF receptor complexes induce receptor activation and signaling V Manfacaš, A Kochoyan , E Bock - Journal of , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1471-4159.2010.06718.x Peptide growth factors can provoke TG Parker, SE Packer - The Journal of clinical , 1990 - Am Soc Clin Investighttps://www.jci.org/articles/view/114466 GAG mimetic libraries: sulphated peptide as heparin-like glycosaminoglycan mimics in their interaction with FGF-1 S Vazquez-Campos, PM St. Hilaire - QSAR & , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/qsar.200420100 Effects of FGF receptor peptide agonists on animal behavior under normal and pathological conditions O Rudenko, V Tkach, V Berezin, E Bock - Neuroscience research, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168010210001392 Hyper Stable Variants of FGF-1-FGF-2 Dimer MS McClanahan - 2022 - scholarworks.uark.eduhttps://scholarworks.uark.edu/chbcuht/38/ Calcium-destabilizing and neurodegenerative effects of aggregated beta-amyloid peptide are attenuated by basic FGF MP Mattson , KJ Tomaselli, RE Rydel - Brain research, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/000689939390295X Ability of the hydrophobic FGF and basic TAT peptides to promote cellular uptake of recombinant Cre recombinase: a tool for efficient genetic engineering of M Peitz, K Pfannkuche, K Rajewsky - Proceedings of the , 2002 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.032068699 Linkage of sugar chains to a fragment peptide of FGF-5S by a chemoenzymatic strategy and changes in the rate of proteolytic hydrolysis K Ajisaka, M Miyasato, C Ito, Y Fujita, Y Yamazaki - Glycoconjugate , 2001 - Springerhttps://link.springer.com/article/10.1023/A:1013613014830 In vitro inhibition of the actions of basic FGF by a novel 16 amino acid peptide I Cosic, AE Drummond, JR Underwood - Molecular and cellular , 1994 - Springerhttps://link.springer.com/article/10.1007/BF01084262 Inhibition of FGF-stimulated phosphatidylinositol hydrolysis and neurite outgrowth by a cell-membrane permeable phosphopeptide H Hall, EJ Williams, SE Moore, FS Walsh , A Prochiantz - Current Biology, 1996 - cell.comhttps://www.cell.com/fulltext/S0960-9822(02)00544-4 Identification of FGF receptor-binding peptides for cancer gene therapy F Maruta, AL Parker, KD Fisher, MT Hallissey - Cancer gene , 2002 - nature.comhttps://www.nature.com/articles/7700470 Primary structure of bovine pituitary basic fibroblast growth factor (FGF) and comparison with the amino-terminal sequence of bovine brain acidic FGF. F Esch, A Baird , N Ling, N Ueno , F Hill - Proceedings of the , 1985 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.82.19.6507 Peptide growth factors in the intestine AU Dignass, A Sturm - European journal of gastroenterology & , 2001 - journals.lww.comhttps://journals.lww.com/eurojgh/fulltext/2001/07000/peptide_growth_factors_in_the_intestine.2.aspx A permeable FGF-1 nuclear localization sequence peptide induces DNA synthesis independently of Ras activation A Komi, A Ishisaki, M Suzuki , T Imamura - Experimental cell research, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014482702000290 Radioimmunoassay for fibroblast growth factor (FGF): release by the bovine anterior pituitary in vitro A Baird , P Böhlen, N Ling, R Guillemin - Regulatory peptides, 1985 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011585900436 Receptor-and heparin-binding domains of basic fibroblast growth factor. A Baird , D Schubert, N Ling - Proceedings of the , 1988 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.85.7.2324

H-GWMTNNPPIPVGEIYKRW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GWMTNNPPIPVGEIYKRW-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GWMTNNPPIPVGEIYKRW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GWMTNNPPIPVGEIYKRW-OH at the technical inquiry form on this page

Please enquire for more information about IGFBP6 protein (His tag) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about 2,2'-(Azanediylbis(ethane-2,1-diyl))bis(1H-benzo[de]isoquinoline-1,3(2H)-dione) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal Aeromonas caviae antibody

Rabbit polyclonal MMP14 antibody

Rabbit polyclonal TSPAN5 antibody

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

H-TITTAYYR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TITTAYYR-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TITTAYYR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TITTAYYR-OH at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Peptide H-FLNWQNLLNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLNWQNLLNV-OH include the following: T cell immunity to Kaposi's sarcoma-associated herpesvirus latent proteins S Sabbah - 2012 - etheses.bham.ac.ukhttps://etheses.bham.ac.uk/id/eprint/3273/ Identification of cytotoxic T lymphocyte epitopes of human herpesvirus 8 F Micheletti, P Monini, C Fortini, P Rimessi - , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1046/j.1365-2567.2002.01424.x CD8+ T cell immunity to Epstein-Barr virus and Kaposi's sarcoma-associated herpes virus AD Hislop, S Sabbah - Seminars in cancer biology, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1044579X08000813

t-Boc-N-amido-PEG2-Amine

Cyclo[Arg-Gly-Asp-D-Phe-Lys(Azide)] is a peptide that contains the RGD sequence. It is a synthetic cyclic peptide that has been shown to bind to integrin receptors, which are cell surface receptors found in many cells. These integrins are involved in cellular adhesion and signaling. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Azide)] can be used as a tool for click chemistry, as it can be modified with other molecules such as azides, which can then be used for click reactions with other molecules. This peptide has also been shown to have biological activity against cancer cells and inflammation.

Peptide H-WASRELERF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WASRELERF-OH include the following: Differential narrow focusing of immunodominant human immunodeficiency virus gag-specific cytotoxic T-lymphocyte responses in infected African and caucasoid PJR Goulder , C Brander, K Annamalai - Journal of , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.74.12.5679-5690.2000 Identification of a novel HIA-B* 3501-restricted cytotoxic T lymphocyte epitope using overlapping peptides PJR Goulder , A Edwards, RE Phillips, AJ McMichael - Aids, 1997 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/1997/07000/identification_of_a_novel_hia_b_3501_restricted.15.aspx Novel and Promiscuous CTL Epitopes in CM Gray , SAK McIntyre, HW Sheppard, H Bredell - J Immunol, 2004 - academia.eduhttps://www.academia.edu/download/49499382/4607.pdf Phenotypic and functional characteristics of HIV-specific CD8 T cells and gag sequence variability after autologous dendritic cells based therapeutic vaccine A Lopez, N van der Lubbe, S Sanchez-Palomino - Vaccine, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X09011979

HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

H-ATPMEAELARRSLAQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ATPMEAELARRSLAQ-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ATPMEAELARRSLAQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ATPMEAELARRSLAQ-OH at the technical inquiry form on this page

Affinity purified Rabbit polyclonal TIMP2 antibody

Purified Polyclonal Cathepsin V antibody

Rabbit polyclonal p62 DOK antibody

STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG

Affinity Purified Chicken anti-Campylobacter Jejuni (206) - Reacts with Fibronectin-binding outer membrane protein.

The CD205 antibody is a highly specialized test compound used in various research applications. It is a monoclonal antibody that specifically targets CD205, a protein expressed on the surface of certain cells. This antibody has been extensively studied and proven to be effective in detecting and analyzing CD205 expression. In addition to its diagnostic capabilities, the CD205 antibody has also shown promising potential as a therapeutic agent. It can effectively inhibit the activity of protein kinases, which play crucial roles in cell signaling and regulation. By blocking these kinases, the CD205 antibody can disrupt abnormal cellular processes and potentially treat diseases such as cancer. Furthermore, this antibody has demonstrated strong binding affinity to collagen, an essential component of connective tissues. This property makes it useful for studying collagen-related disorders and developing targeted therapies. The CD205 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their specific experiments. Its versatility and reliability make it an invaluable tool for scientists working

Mouse monoclonal CENPH antibody

Please enquire for more information about MD-224 including the price, delivery time and more detailed product information at the technical inquiry form on this page

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

H-SLAEEEIIIRSENLT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLAEEEIIIRSENLT-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLAEEEIIIRSENLT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLAEEEIIIRSENLT-OH at the technical inquiry form on this page

H-FFRENLAFPQGEARE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FFRENLAFPQGEARE-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FFRENLAFPQGEARE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FFRENLAFPQGEARE-OH at the technical inquiry form on this page

Ac-QRAPDRVLSHSGQQQC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-QRAPDRVLSHSGQQQC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-QRAPDRVLSHSGQQQC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-QRAPDRVLSHSGQQQC-NH2 at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of MINK1 antibody, catalog no. 70R-7944

Rabbit Polyclonal OR6T1 antibody

Purified Polyclonal Pepsinogen C antibody

IACS-8968 is an activator that binds to specific receptors and ion channels. It is used as a research tool for studying the effects of ligands on cell biology. IACS-8968 has also been shown to be an inhibitor of phosphoinositide 3-kinase (PI3K) and protein kinase C (PKC).

Human sequence expressed in NS0 Cells; purity >97% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

H-LSKLLSFMAPIDHTTMSDDA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LSKLLSFMAPIDHTTMSDDA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LSKLLSFMAPIDHTTMSDDA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LSKLLSFMAPIDHTTMSDDA-OH at the technical inquiry form on this page

Peptide H-KQL^ATKAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KQL^ATKAAR-OH include the following: Identification of lysine acetyltransferase p300 substrates using 4-pentynoyl-coenzyme A and bioorthogonal proteomics Y Yu-Ying, G Markus, HC Howard - Bioorganic & medicinal chemistry , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0960894X11006895 Evaluation of chemical fluorescent dyes as a protein conjugation partner for live cell imaging Y Hayashi-Takanaka, TJ Stasevich , H Kurumizaka - PloS one, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0106271 Comparative proteomic analysis of histone post-translational modifications upon ischemia/reperfusion-induced retinal injury X Zhao, S Sidoli , L Wang , W Wang, L Guo - Journal of proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr500040a The histone acetyltransferase p300 inhibitor C646 reduces pro-inflammatory gene expression and inhibits histone deacetylases T Van Den Bosch, A Boichenko , NGJ Leus - Biochemical , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006295215007650 Drawbacks in the use of unconventional hydrophobic anhydrides for histone derivatization in bottom-up proteomics PTM analysis S Sidoli , ZF Yuan , S Lin, K Karch, X Wang - , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201400483 One minute analysis of 200 histone posttranslational modifications by direct injection mass spectrometry S Sidoli , Y Kori, M Lopes, ZF Yuan , HJ Kim - Genome , 2019 - genome.cshlp.orghttps://genome.cshlp.org/content/29/6/978.short Sequential Window Acquisition of all Theoretical Mass Spectra (SWATH) Analysis for Characterization and Quantification of Histone Post-translational Modifications S Sidoli , S Lin, L Xiong, NV Bhanu, KR Karch - Molecular & Cellular , 2015 - ASBMBhttps://www.mcponline.org/article/S1535-9476(20)32648-7/fulltext SWATH analysis for characterization and quantification of histone post-translational modifications S Sidoli , S Lin, L Xiong, NV Bhanu, KR Karch - Mol. Cell , 2015 - academia.eduhttps://www.academia.edu/download/56419420/mcp.O114.046102.full.pdf Complete workflow for analysis of histone post-translational modifications using bottom-up mass spectrometry: from histone extraction to data analysis S Sidoli , NV Bhanu, KR Karch, X Wang - JoVE (Journal of , 2016 - jove.comhttps://www.jove.com/t/54112/complete-workflow-for-analysis-histone-post-translational A mass spectrometry-based assay using metabolic labeling to rapidly monitor chromatin accessibility of modified histone proteins S Sidoli , M Lopes, PJ Lund, N Goldman , M Fasolino - Scientific reports, 2019 - nature.comhttps://www.nature.com/articles/s41598-019-49894-4 Low resolution data-independent acquisition in an LTQ-Orbitrap allows for simplified and fully untargeted analysis of histone modifications S Sidoli , J Simithy , KR Karch, K Kulej - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b03009 Characterization of individual histone posttranslational modifications and their combinatorial patterns by mass spectrometry-based proteomics strategies S Sidoli , BA Garcia - Histones: Methods and Protocols, 2017 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-6630-1_8 Variations of histone modification patterns: contributions of inter-plant variability and technical factors S Brabencova, I Ihnatova, D PotÄ›šil, M Fojtova - Frontiers in plant , 2017 - frontiersin.orghttps://www.frontiersin.org/journals/plant-science/articles/10.3389/fpls.2017.02084/full Pitfalls in histone propionylation during bottom-up mass spectrometry analysis P Meert, E Govaert, E Scheerlinck, M Dhaenens - , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201400569 HDAC1-3 inhibitor MS-275 enhances IL10 expression in RAW264.7 macrophages and reduces cigarette smoke-induced airway inflammation in mice NGJ Leus, T van den Bosch, PE van der Wouden - Scientific reports, 2017 - nature.comhttps://www.nature.com/articles/srep45047 HDAC 3-selective inhibitor RGFP966 demonstrates anti-inflammatory properties in RAW 264.7 macrophages and mouse precision-cut lung slices by NGJ Leus, PE van der Wouden - Biochemical , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006295216001635 Turnover of histones and histone variants in postnatal rat brain: effects of alcohol exposure N Rachdaoui, L Li , B Willard, T Kasumov , S Previs - Clinical , 2017 - Springerhttps://link.springer.com/article/10.1186/s13148-017-0416-5 Proteomic interrogation of human chromatin MP Torrente , BM Zee , NL Young , RC Baliban - PLoS , 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0024747 Extensive histone post-translational modification in honey bees MJ Dickman , R Kucharski, R Maleszka - Insect biochemistry and , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S096517481200166X Mass spectrometry analysis of Arabidopsis histone H3 reveals distinct combinations of post-translational modifications L Johnson, S Mollah, BA Garcia - Nucleic acids , 2004 - academic.oup.comhttps://academic.oup.com/nar/article-abstract/32/22/6511/2375657 hSWATH: unlocking SWATH's full potential for an untargeted histone perspective L De Clerck, S Willems , R Noberini - Journal of proteome , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.9b00214 Differentiation between peptides containing acetylated or tri-methylated lysines by mass spectrometry: An application for determining lysine 9 acetylation and K Zhang , PM Yau , B Chandrasekhar, R New - , 2004 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200300503 Natural isotope correction improves analysis of protein modification dynamics J Dietze, A van Pijkeren, AS Egger , M Ziegler - Analytical and , 2021 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03732-7 Comparison of data-acquisition methods for the identification and quantification of histone post-translational modifications on a Q Exactive HF hybrid quadrupole J Cole, EJ Hanson, DC James - Rapid , 2019 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.8401 A quantitative atlas of histone modification signatures from human cancer cells G LeRoy , PA DiMaggio , EY Chan, BM Zee - Epigenetics & , 2013 - Springerhttps://link.springer.com/article/10.1186/1756-8935-6-20 Identification of histone modifications reveals a role of H2b monoubiquitination in transcriptional regulation of dmrt1 in Monopterus albus F Lai, Y Cheng, J Zou, H Wang, W Zhu - journal of biological , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8193266/ Post-translational modification of human histone by wide tolerance of acetylation C Li, HP Choi, X Wang, F Wu, X Chen, X Lu, R Jing - Cells, 2017 - mdpi.comhttps://www.mdpi.com/2073-4409/6/4/34 Streamlined discovery of cross-linked chromatin complexes and associated histone modifications by mass spectrometry BM Zee , AA Alekseyenko - Proceedings of the , 2016 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1522750113

Affinity purified Rabbit polyclonal PACAP antibody

The RLN1 gene encodes a protein that is involved in the regulation of cell growth, differentiation, and apoptosis. It interacts with a number of proteins involved in cancer, tumour progression and metastasis. The function of RLN1 is to interact with other proteins, such as p53 and BRCA2, and regulate their activity. The frequency of this gene has been analysed in healthy controls versus patients with cancer. A number of different tissues have been analysed for this gene including testicular tissue from healthy controls versus patients with testicular cancer. There are also data on the expression levels in normal tissue and cancerous tissue from the same individual. This gene has also been shown to be homologous to other genes that are involved in DNA repair and apoptosis.

Rabbit Polyclonal CAPN12 antibody

Peptide H-LSRFSWGAEGQRPGFGYGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSRFSWGAEGQRPGFGYGG-OH include the following: Different Development of Myelin Basic PA Muraro, R Martin , K Ito, NI Quigley, A Necker - J , 2008 - researchgate.nethttps://www.researchgate.net/profile/Jacqueline-Quandt/publication/23297271_Different_Development_of_Myelin_Basic_Protein_Agonist-_and_Antagonist-Specific_Human_TCR_Transgenic_T_Cells_in_the_Thymus_and_Periphery/links/56a25f9f08ae1b65112c8f9e/Different-Development-of-Myelin-Basic-Protein-Agonist-and-Antagonist-Specific-Human-TCR-Transgenic-T-Cells-in-the-Thymus-and-Periphery.pdf Human T cell receptor and human leukocyte antigen class II transgenic mouse as a new model for multiple sclerosis MN Baig - 2001 - search.proquest.comhttps://search.proquest.com/openview/45a4d7b0561e8d27062c999cf83381f4/1?pq-origsite=gscholar&cbl=18750&diss=y Different development of myelin basic protein agonist-and antagonist-specific human TCR transgenic T cells in the thymus and periphery K Kawamura, K Yao, JA Shukaliak-Quandt - The Journal of , 2008 - journals.aai.orghttps://journals.aai.org/jimmunol/article/181/8/5462/78588 Forced Fox-P3 expression can improve the safety and antigen-specific function of engineered regulatory T cells J McGovern, A Holler, S Thomas, HJ Stauss - Journal of Autoimmunity, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0896841122000968

Rabbit polyclonal RAB27A antibody

CP 21 is a drug that has been found to be effective in the treatment of autoimmune diseases and cancer, with a high specificity for cancer tissues. CP 21 is a humanized antibody fragment that binds to β-catenin protein, which is involved in the activation of Wnt signaling pathways. CP 21 has been shown to inhibit the proliferation of chronic kidney cells and can reduce the glomerular filtration rate in rats. CP 21 also blocks the binding of β-catenin to other proteins, inhibiting its activity. This drug may also have therapeutic potential in treating neoplastic diseases such as colon cancer and breast cancer.

Peptide H-DI^TP^TLTL^YVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DI^TP^TLTL^YVGK^-OH include the following: Comparative plasma proteome analysis of lymphoma-bearing SJL mice VB Bhat , MH Choi , JS Wishnok - Journal of proteome , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr0501463

HNRNPA2B1 antibody was raised in Rabbit using Human HNRNPA2B1 as the immunogen

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

ZIM3 antibody was raised in rabbit using the middle region of ZIM3 as the immunogen

MUC1 antibody was raised in mouse using purified native MUC1 as the immunogen.

Peptide H-GPSSVEDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GPSSVEDIK-OH include the following: Characterisation of the interface between nucleophosmin (NPM) and p53: potential role in p53 stabilisation B Lambert, M Buckle - FEBS letters, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579305014869

Please enquire for more information about D-Galactonic acid-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Avitriptan is used to treat migraine headaches, as well as other types of headaches. It belongs to the category of anti-migraine drugs and is available in oral, injectable, nasal spray, and suppository forms. Avitriptan binds selectively to neurokinin-1 (NK1) receptors on the trigeminal nerve endings in the brain that are responsible for pain transmission. This drug has shown clinical relevance in treating coronary heart diseases and reducing blood pressure levels. There have been a number of clinical studies that have demonstrated its effectiveness in treating migraine headaches. The concentration-response curve for avitriptan has been found to be dose-dependent, with a plateau at doses greater than 100 mg.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF365 antibody, catalog no. 20R-1067

A synthetic peptide for use as a blocking control in assays to test for specificity of UCK1 antibody, catalog no. 70R-10374

Peptide H-STAPPAHGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-STAPPAHGV-OH include the following: Efficient discovery of immune response targets by cyclical refinement of QSAR models of peptide binding V Brusic , K Bucci, C Schönbach , N Petrovsky - Journal of Molecular , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1093326300000991 Induction of HLA-A2-restricted CTLs to the mucin 1 human breast cancer antigen. V Apostolopoulos , V Karanikas, JS Haurum - (Baltimore, Md.: 1950 , 1997 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/159/11/5211/30949 Getting into the groove: unusual features of peptide binding to MHC class I molecules and implications in vaccine design V Apostolopoulos , IF McKenzie, IA Wilson - Front Biosci, 2001 - article.imrpress.comhttps://article.imrpress.com/bri/Landmark/articles/pdf/LandmarkA683.pdf Vaccine Development Against Novel Breast Cancer Antigens V Apostolopoulos , I McKenzie - 2002 - apps.dtic.milhttps://apps.dtic.mil/sti/citations/tr/ADA409560 Anti-MUC1 antibodies react directly with MUC1 peptides presented by class I H2 and HLA molecules V Apostolopoulos , G Chelvanayagam - The Journal of , 1998 - journals.aai.orghttps://journals.aai.org/jimmunol/article/161/2/767/31120 Delivery of tumor associated antigens to antigen presenting cells using penetratin induces potent immune responses V Apostolopoulos , DS Pouniotis, PJ van Maanen - Vaccine, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X06000569 Sequence-variant repeats of MUC1 show higher conformational flexibility, are less densely O-glycosylated and induce differential B lymphocyte responses S von Mensdorff-Pouilly, L Kinarsky, K Engelmann - , 2005 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/15/8/735/637686 Reactivity of natural and induced human antibodies to MUC1 mucin with MUC1 peptides and n-acetylgalactosamine (GalNAc) peptides S von Mensdorff-Pouilly, E Petrakou - Journal of Cancer, 2000 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0215(20000601)86:5%3C702::AID-IJC16%3E3.0.CO;2-1 HUMORAL IMMUNE RESPONSES BY IMMUNIZATIONS WITH FULLY SYNTHETIC THREE-COMPONENT CANCER VACCINE CANDIDATES PS Thompson - SYNTHESIS AND IMMUNOTHERAPEUTIC STUDIES - getd.libs.uga.eduhttp://getd.libs.uga.edu/pdfs/thompson_pamela_s_201112_phd.pdf#page=142 MUC1-specific Cytotoxic T Lymphocytes Eradicate Tumors When Adoptively Transferred in Vivo P Mukherjee , AR Ginardi, TL Tinder, CJ Sterner - Clinical cancer , 2001 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/7/3/848s/200197 Mice with spontaneous pancreatic cancer naturally develop MUC-1-specific CTLs that eradicate tumors when adoptively transferred P Mukherjee , AR Ginardi, CS Madsen - The Journal of , 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/165/6/3451/69796 Tumour-associated antigenic peptides are present in the HLA class I ligandome of cancer cell line derived extracellular vesicles P Kumar , C Boyne, S Brown, A Qureshi, P Thorpe - , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imm.13471 A central core structure in an antibody variable domain determines antigen specificity P Jirholt, L Strandberg, B Jansson - Protein , 2001 - academic.oup.comhttps://academic.oup.com/peds/article-abstract/14/1/67/1575510 Identification of HLA-A2-restricted T-cell epitopes derived from the MUC1 tumor antigen for broadly applicable vaccine therapies P Brossart, KS Heinrich, G Stuhler - Blood, The Journal , 1999 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/93/12/4309/260963 Synthesis and immunological evaluation of a multicomponent cancer vaccine candidate containing a long MUC1 glycopeptide NT Supekar , V Lakshminarayanan - , 2018 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201700424 STUDY ON THE EFFECT OF LINKERS IN MONOGLYCOSYLATED LMUC1-BASED MULTICOMPONENT CANCER VACCINE CANDIDATES. NT Supekar - SYNTHESIS AND IMMUNOLOGICAL EVALUATION OF - getd.libs.uga.eduhttps://getd.libs.uga.edu/pdfs/supekar_nitin_t_201612_phd.pdf#page=141 SYNTHESIS AND IMMUNOLOGICAL EVALUATION OF MONOGLYCOSYLATED FULL-LENGTH MUC1-BASED MULTICOMPONENT CANCER VACCINE NT Supekar - SYNTHESIS AND IMMUNOLOGICAL EVALUATION OF - getd.libs.uga.eduhttp://getd.libs.uga.edu/pdfs/supekar_nitin_t_201612_phd.pdf#page=80 Identification of an HLA-A11-restricted epitope from the tandem repeat domain of the epithelial tumor antigen mucin. N Domenech , RA Henderson , OJ Finn - Journal of immunology , 1995 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/155/10/4766/29001 Immunogenicity of a tripartite cell penetrating peptide containing a MUC1 variable number of tandem repeat (VNTR) and AT helper epitope N Brooks, J Hsu, S Esparon, D Pouniotis, GA Pietersz - Molecules, 2018 - mdpi.comhttps://www.mdpi.com/1420-3049/23/9/2233 Mucin-type O-glycosylation and its potential use in drug and vaccine development MA Tarp, H Clausen - Biochimica et Biophysica Acta (BBAhttps://www.sciencedirect.com/science/article/pii/S0304416507002164 Identification of three non-VNTR MUC1-derived HLA-A*0201-restricted T-cell epitopes that induce protective anti-tumor immunity in HLA-A2/Kb-transgenic mice LC Heukamp, SH van der Burg - journal of cancer, 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1097-0215(200002)9999:9999%3C::AID-IJC1051%3E3.0.CO;2-Z MUC1 peptide vaccination in patients with advanced pancreas or biliary tract cancer K Yamamoto, T Ueno, T Kawaoka, S Hazama - Anticancer , 2005 - ar.iiarjournals.orghttps://ar.iiarjournals.org/content/25/5/3575.short CG IOANNIDES, B. FISK, KR JEROME, B. CHESAK, T. IRIMURA JT WHARTON, OJ FINN - Ovarian Cancer 3, 2012 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=mMQkBAAAQBAJ&oi=fnd&pg=PA317&dq=(%22NH2-Ser-Thr-Ala-Pro-Pro-Ala-His-Gly-Val-OH%22+OR+%22H-STAPPAHGV-OH%22+OR+%22STAPPAHGV%22)+AND+peptide&ots=X5M8t6Cp2g&sig=cdKQJyLAlV_P86oWpENGmUqCpXo Selection and characterization of MUC1-specific CD8+ T cells from MUC1 transgenic mice immunized with dendritic-carcinoma fusion cells J Gong, V Apostolopoulos , D Chen, H Chen - , 2000 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1046/j.1365-2567.2000.00101.x Context of MUC1 epitope: immunogenicity IS Quinlin, JS Burnside, KE Dombrowski - Oncology , 2007 - spandidos-publications.comhttps://www.spandidos-publications.com/or/17/2/453 substrate primary amino acid sequence on the activity of human UDP-N-acetylgalactosamine: polypeptide N-acetylgalactosaminyltransferase. Studies with I Nishimori, NR Johnson, SD Sanderson - Journal of Biological , 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925817339819 A 16-mer peptide (RQIKIWFQNRRMKWKK) from antennapedia preferentially targets the Class I pathway GA Pietersz, W Li, V Apostolopoulos - Vaccine, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X0000373X Presentation of MUC1 tumor antigen by class I MHC and CTL function correlate with the glycosylation state of the protein taken up by dendritic cells EM Hiltbold , MD Alter, P Ciborowski , OJ Finn - Cellular immunology, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0008874999915125 MUC1-specific cytotoxic T lymphocytes in cancer therapy: induction and challenge D Roulois, M Gregoire - BioMed research , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2013/871936 Oxidized and reduced mannan mediated MUC1 DNA immunization induce effective anti-tumor responses CK Tang, KC Sheng, D Pouniotis, S Esparon, HY Son - Vaccine, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X08005744 Ovarian tumour reactive cytotoxic T lymphocytes can recognize peptide determinants on polymorphic epithelial mucins Muc-1 CG Ioannides, B Fisk, KR Jerome , B Chesak, T Irimura - Ovarian Cancer 3, 1995 - Springerhttps://link.springer.com/chapter/10.1007/978-1-4757-0136-4_31 Rapid induction of primary human CD4+ and CD8+ T cell responses against cancer-associated MUC1 peptide epitopes. B Agrawal, MJ Krantz, MA Reddish - International , 1998 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/10/12/1907/744541 MUC1 immunobiology: from discovery to clinical applications AM Vlad , JC Kettel, NM Alajez , CA Carlos - Advances in , 2004 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=Bc8PmpSIaUIC&oi=fnd&pg=PA249&dq=(%22NH2-Ser-Thr-Ala-Pro-Pro-Ala-His-Gly-Val-OH%22+OR+%22H-STAPPAHGV-OH%22+OR+%22STAPPAHGV%22)+AND+peptide&ots=QXOvRS5d5C&sig=2B1-87LX83Vbg5pRG_U4MAnoTAw Bridging innate and adaptive antitumor immunity targeting glycans A Pashov , B Monzavi-Karbassi - BioMed Research , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2010/354068

A synthetic peptide for use as a blocking control in assays to test for specificity of PRKCZ antibody, catalog no. 70R-2654

Purified recombinant Human PSMB5 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of OPN3 antibody, catalog no. 70R-9890

H-SEKINKRSGPKRG-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SEKINKRSGPKRG-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SEKINKRSGPKRG-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SEKINKRSGPKRG-NH2 at the technical inquiry form on this page

Rabbit polyclonal LCK antibody

The PIM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets insulin and is commonly used to study insulin-related processes and functions. The antibody is produced using recombinant antigen technology, ensuring high specificity and sensitivity. It recognizes histidine residues on the insulin molecule, allowing for precise detection and analysis. The PIM1 antibody has been extensively tested and validated for its neutralizing and cytotoxic properties against insulin and related growth factors. It can be used in various applications, including immunohistochemistry, Western blotting, ELISA, and flow cytometry. Researchers rely on the PIM1 antibody to gain insights into insulin signaling pathways, autoantibodies against insulin in human serum, epidermal growth factor interactions, and other important biological processes involving insulins and growth factors.

Please enquire for more information about (S)-Pro-xylane including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Polyclonal Cytokeratin 14 antibody

H-DLAFPGSGEQVEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DLAFPGSGEQVEK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DLAFPGSGEQVEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DLAFPGSGEQVEK-OH at the technical inquiry form on this page