Biochemicals and Reagents

Peptide H-ELLETVVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELLETVVNR-OH include the following: Peptide serum markers in islet autoantibody-positive children C von Toerne, M Laimighofer, P Achenbach - Diabetologia, 2017 - Springerhttps://link.springer.com/article/10.1007/s00125-016-4150-x

H-DVINGSPISQKIIYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DVINGSPISQKIIYK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DVINGSPISQKIIYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DVINGSPISQKIIYK-OH at the technical inquiry form on this page

Mouse monoclonal TOM70 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRE antibody, catalog no. 70R-5193

Sniper ER-87 is a potent and selective activator of the TRPM2 ion channel. Sniper ER-87 binds to TRPM2 with high affinity, and activates the channel with an EC50 of 0.4 μM in a cell-based assay. Sniper ER-87 is also able to inhibit activation of the TRPM2 ion channel by cold stimuli. The antibody can be used as a research tool for studying TRPM2 protein interactions, as well as pharmacological studies on TRPM2 ligands.

Goat anti-human kappa chain (HRP) was raised in goat using human kappa chain as the immunogen.

Mouse monoclonal NGAL antibody

HBcAg antibody was raised in mouse using purified HBcAg as the immunogen.

Rabbit polyclonal DFF45 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GJA1 antibody, catalog no. 70R-6087

Purified Polyclonal Cytochrome P450 2A6 antibody

COG 133 is a conjugate of the nicotinic acetylcholine receptor agonist, nicotine, and an amyloid protein. The COG 133 analog was found to be effective in animal models of inflammatory bowel disease (IBD). COG 133 has been shown to reduce the production of TNF-α and other inflammatory cytokines in vitro and in vivo. This analog also contains a region that encompasses the active site of the nicotinic acetylcholine receptor, which may account for its efficacy. COG 133 inhibits inflammation by binding with high affinity to the nicotinic acetylcholine receptors on macrophages, leading to decreased production of pro-inflammatory cytokines such as TNF-α and IL-6.

Rabbit polyclonal alpha Synuclein antibody

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

Ravoxertinib hydrochloride is an investigational pharmaceutical compound, specifically a selective small molecule inhibitor. It is synthesized chemically, designed to target and inhibit specific protein kinases, particularly those associated with the ERK signaling pathway. The mode of action involves binding to these kinases, thus preventing their phosphorylation and subsequent activation. This interruption of the cellular signaling cascade can result in the suppression of tumor cell proliferation and survival. Ravoxertinib hydrochloride is primarily being explored for its therapeutic potential in the treatment of various cancers, particularly those driven by aberrant RAS-RAF-MEK-ERK pathway activation. It aims to provide a targeted approach, potentially enhancing the efficacy of cancer therapies while minimizing impacts on normal cells. Ongoing studies are focusing on its application in cancers such as melanoma and non-small cell lung cancer, where ERK pathway mutations or dysregulations are prevalent. The development and application of Ravoxertinib hydrochloride represent promising strides in the advancement of precision oncology.

Rabbit polyclonal IGF1R antibody

H-VTV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTV-OH at the technical inquiry form on this page

Mouse monoclonal COX6A1 antibody

H-MFSLPLESDSMDPFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MFSLPLESDSMDPFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MFSLPLESDSMDPFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MFSLPLESDSMDPFR-OH at the technical inquiry form on this page

Pritelivir mesylate is an antiviral compound, which is derived from thiazolylamide class molecules, with a targeted mechanism of action against the herpes simplex virus (HSV). It functions by inhibiting the viral helicase-primase complex, which is essential for the replication of viral DNA. This distinct mode of action differentiates it from traditional treatments like acyclovir, which targets viral DNA polymerase. Pritelivir mesylate is primarily used in the treatment and suppression of HSV infections, including HSV-1 and HSV-2. By targeting the helicase-primase, it effectively reduces the replication of the virus, leading to decreased viral shedding and lesion formation. Its unique pathway offers an alternative for cases where resistance to standard antivirals occurs. Given its potential, Pritelivir mesylate is under extensive study to better understand its efficacy and safety profile. Its promising results in early clinical trials may provide a significant advancement in antiviral therapies, offering new hope for managing and controlling HSV infections.

H-MEDNNMLPQFIHGIC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MEDNNMLPQFIHGIC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MEDNNMLPQFIHGIC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MEDNNMLPQFIHGIC-NH2 at the technical inquiry form on this page

CYCS antibody was raised in Rabbit using Human CYCS as the immunogen

Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin    : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.

Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK

A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF4 antibody, catalog no. 70R-9666

1,6-Anhydro-?-D-mannofuranose

LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Peptide H-SSPAVEQQLLVSGPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SSPAVEQQLLVSGPGK^-OH include the following: Development of a rapid and sensitive multiple reaction monitoring proteomic approach for quantification of transporters in human liver tissue L Wang , KJ Rubadue, J Alberts, DW Bedwell - of Chromatography B, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023217305482 Quantification of membrane transporter proteins in human lung and immortalized cell lines using targeted quantitative proteomic analysis by isotope dilution nanoLC JK Fallon , N Houvig, CL Booth-Genthe - Journal of Pharmaceutical , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708517324226 OATP1A2 and OATP2B1 are interacting with dopamine-receptor agonists and antagonists AM Schaefer, HE Meyer zu Schwabedissen - Molecular , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.molpharmaceut.0c00159

Angiotensin

α-ω-Disuccinimidyl ester poly (ethyleneglycol), PEG molecular weight 3,000 daltons

ML336 is an antiviral agent that inhibits the replication of alphaviruses. ML336 has been shown to be effective against a variety of viruses, including those that are resistant to other antiviral agents. It binds to the viral envelope protein and inhibits virus entry into the host cell, which prevents the virus from replicating. The mechanism of action of ML336 is similar to that of the human immunodeficiency virus (HIV) inhibitor Maraviroc. Clinical trials have shown that ML336 is efficacious in inhibiting cellular and animal viruses, such as HIV-1, HIV-2, simian immunodeficiency virus (SIV), human cytomegalovirus (HCMV), and dengue fever virus (DENV).

CASP3 antibody was raised in rabbit using the N terminal of CASP3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SNAG1 antibody, catalog no. 70R-5764

AATF antibody was raised in Rabbit using Human AATF as the immunogen

Peptide H-DDNPNLPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DDNPNLPR-OH include the following: Improved sensitivity for protein turnover quantification by monitoring Immonium ion Isotopologue abundance TE Angel , BC Naylor, JC Price , C Evans - Analytical , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b01329 Identification of inherently antioxidant regions in proteins with radical-directed dissociation mass spectrometry OM Hamdy , S Lam, RR Julian - Analytical chemistry, 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac500425f Quantitative bottom-up proteomics depends on digestion conditions MS Lowenthal, Y Liang, KW Phinney - Analytical , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4027274 Application of volumetric absorptive microsampling for robust, high-throughput mass spectrometric quantification of circulating protein biomarkers I van den Broek, Q Fu, S Kushon, MP Kowalski - Clinical Mass , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2376999817300181 Clinical Mass Spectrometry I van den Broek, Q Fu, S Kushon, MP Kowalski, K Millis - researchgate.nethttps://www.researchgate.net/profile/Irene-Broek/publication/319436037_Application_of_volumetric_absorptive_microsampling_for_robust_high-throughput_mass_spectrometric_quantification_of_circulating_protein_biomarkers/links/613b00efd1bbee063c5e2c40/Application-of-volumetric-absorptive-microsampling-for-robust-high-throughput-mass-spectrometric-quantification-of-circulating-protein-biomarkers.pdf?_sg%5B0%5D=started_experiment_milestone&origin=journalDetail Proteomics Study on Cross-linking Reaction of Formaldehyde and HSA B Li, DY Hu, XL Xin, R Lan, YL Deng - Advanced Materials , 2012 - Trans Tech Publhttps://www.scientific.net/AMR.343-344.1035

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Please enquire for more information about Benzyl 4-phenylbutanoate including the price, delivery time and more detailed product information at the technical inquiry form on this page

5-Hydroxytryptophol

A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf71 antibody, catalog no. 70R-3221

TBC1D13 antibody was raised using the middle region of TBC1D13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

H-GGGQEGPEYWEMQTQRAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGGQEGPEYWEMQTQRAK-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGGQEGPEYWEMQTQRAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGGQEGPEYWEMQTQRAK-OH at the technical inquiry form on this page

Roflumilast-d4 is a deuterium-labeled derivative of the PDE4 inhibitor roflumilast, which is commonly used as a stable isotope-labeled internal standard in pharmacokinetic and metabolic studies. This compound is synthesized through the strategic incorporation of deuterium atoms, providing enhanced stability and traceability while maintaining the pharmacological properties of its non-labeled analog. With its specific mode of action, Roflumilast-d4 functions by selectively inhibiting phosphodiesterase 4 (PDE4), an enzyme responsible for breaking down cyclic adenosine monophosphate (cAMP) in inflammatory cells. This inhibition leads to an increase in intracellular cAMP levels, subsequently reducing inflammatory responses by downregulating the release of pro-inflammatory cytokines in various cell types. Roflumilast-d4 is pivotal in bioanalytical studies, where it serves as an internal standard for mass spectrometric analysis, enabling accurate quantification of roflumilast in biological samples. Its applications are particularly significant in preclinical and clinical research settings, aiding in the exploration of pharmacokinetics, drug-drug interactions, and metabolic pathways of PDE4 inhibitors.

Purified native Human PAP protein

Affinity purified Rabbit polyclonal Centaurin beta 1 antibody

Mouse monoclonal ZFP36 antibody

Purified STOX2 Antibody

Mouse monoclonal ZFAND2B antibody

GCOM1 antibody was raised using the C terminal Of Gcom1 corresponding to a region with amino acids ERMEKERHQLQLQLLEHETEMSGELTDSDKERYQQLEEASASLRERIRHL

Peptide H-EVFDFSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EVFDFSQR^-OH include the following: A simple method for amino acid selective isotope labeling of recombinant proteins in E. coli KI Tong, M Yamamoto , T Tanaka - Journal of biomolecular NMR, 2008 - Springerhttps://link.springer.com/article/10.1007/s10858-008-9264-0

Teniposide is a cytotoxic drug that is used in the treatment of refractory childhood acute lymphoblastic leukemia. It has antitumour activity. It is a type II topoisomerase inhibitor. This drug inhibits DNA synthesis by forming a complex with topoisomerase II and DNA. Teniposide is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

PPP1R7 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH3 antibody, catalog no. 70R-5167

Research peptide, 95% TFA salt

Please enquire for more information about (E,E) Methyl farnesoate including the price, delivery time and more detailed product information at the technical inquiry form on this page

6β-Hydroxyetiocholanolone is a research tool that activates receptors and ion channels. 6β-Hydroxyetiocholanolone is a ligand that binds to the receptor and activates the receptor, which then transmits the signal to the cell. 6β-Hydroxyetiocholanolone has been shown to be an agonist at many different receptors, including those for GABA, dopamine, serotonin, acetylcholine, and histamine. 6β-Hydroxyetiocholanolone is also an antibody that binds to cell surface proteins through its reactive sulfhydryl group. 6β-Hydroxyetiocholanolone is a high purity protein that can be used in pharmacological studies and experiments with peptides. 6β-Hydroxyetiocholanolone has been shown to inhibit proteases such as trypsin and chymotrypsin in vitro. 6β-Hydroxyetiocholanolone has CAS

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD51AP1 antibody, catalog no. 70R-4861

2-Azidoethyl α-L-fucopyranoside

ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Rabbit Polyclonal ABL1/2 antibody (Tyr393/429)

Region of IL22 protein corresponding to amino acids MAPISSHCRL DKSNFQQPYI TNRTFMLAKE ASLADNNTDV RLIGEKLFHG VSMSERCYLM KQVLNFTLEE VLFPQSDRFQ PYMQEVVPFL ARLSNRLSTC HIEGDDLHIQ RNVQKLKDTV KKLGESGEIK AIGELDLLFM SLRNACI.

CDR2L antibody was raised in Rabbit using Human CDR2L as the immunogen

Rabbit polyclonal RRP1 antibody (FITC)

Human sequence expressed in E. coli Cells; purity >95% by SDS-PAGE and analyzed by silver stain.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF566 antibody, catalog no. 70R-8099

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA12 antibody, catalog no. 70R-6159

Purified recombinant Human CDC34 protein

H-ALTPTPP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALTPTPP-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALTPTPP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALTPTPP-OH at the technical inquiry form on this page

SARS-CoV-2 sequence expressed in HEK-293 Cells; purity >95% by SDS Page; Maltose binding Protein (MBP) Tag.

PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH

Iniparib

DGAT1 antibody was raised in Rabbit using Human DGAT1 as the immunogen

BCCIP antibody was raised in Rabbit using Human BCCIP as the immunogen

ANP (human, 5-28) is a peptide that is used as a research tool for studying the function of ion channels. It is also an antibody that can be used to measure protein interactions. ANP (human, 5-28) has been shown to inhibit protein interactions with the receptor and ligand. This peptide has been shown to act as an activator at high concentrations and an inhibitor at low concentrations.

Rabbit polyclonal FLI1 antibody

AP3S1 antibody was raised using the N terminal of AP3S1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE

THAP11 antibody was raised in Mouse using a purified recombinant fragment of human THAP11 expressed in E. coli as the immunogen.

Peptide H-VEATFGVDESNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VEATFGVDESNAK^-OH include the following: Allergenic risk assessment of enolase leaked from Saccharomyces cerevisiae under pressurization C Jia , Y Wei, J Shi, H Zhang, Y Xiao, Z Gan, G Jia - Food Bioscience, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212429223010507

H-PENPYNTPIFAIKKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PENPYNTPIFAIKKK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PENPYNTPIFAIKKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PENPYNTPIFAIKKK-OH at the technical inquiry form on this page

Please enquire for more information about JHU37160 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant Human RhoD protein

Rabbit polyclonal AQP2 antibody (Ser269)

A synthetic peptide for use as a blocking control in assays to test for specificity of RXFP3 antibody, catalog no. 70R-9809

Peptide H-LTDEEVDEMIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LTDEEVDEMIR-OH include the following: Probing protein 3D structures and conformational changes using electrochemistry-assisted isotope labeling cross-linking mass spectrometry Q Zheng, H Zhang , S Wu , H Chen - Journal of The American , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-016-1356-6 High-resolution mapping of carbene-based protein footprints CC Jumper , R Bomgarden, J Rogers - Analytical , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac300120z

Tos-PEG4-Tos

GABBR2 antibody was raised in Rabbit using Human GABBR2 as the immunogen

M13/fd/F1 filamentous phages antibody was raised in mouse using fd phages from E.Coli F+ strain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SETBP1 antibody, catalog no. 70R-8318

Purified Polyclonal gp91 phox antibody

Orchid maintenance medium with charcoal, without agar

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Polyclonal Ataxin 10 antibody

AZD1480

H-VFLENVIR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VFLENVIR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VFLENVIR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VFLENVIR-OH at the technical inquiry form on this page

MAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA

Recombinant Human Isocitrate Dehydrogenase-1

LDHD antibody was raised in Rabbit using Human LDHD as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5808

The HSV1 gD protein is a recombinant protein and antigen that plays a crucial role in the life cycle of the herpes simplex virus type 1 (HSV-1). It is involved in various processes, including chemokine activation, creatine kinase isoenzyme regulation, and interleukin-6 production. The HSV1 gD protein can be used as a target for monoclonal antibodies with neutralizing properties. This highly purified protein complex is derived from human serum and has been extensively studied in the field of life sciences. Its structure and function have been characterized using advanced techniques such as electrode analysis and 3-kinase assays. By understanding the mechanisms by which the HSV1 gD protein interacts with host cells, researchers can develop new therapeutic strategies to combat HSV-1 infections. This recombinant protein offers a valuable tool for studying viral pathogenesis and developing antiviral drugs.

Catalogue peptide; min. 95% purity

Bis-dPEG®17-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

Rabbit Polyclonal SHP1 antibody (Tyr536)

Pepstatin A

Applications A dueterated isotope of Methylamine (M285560) a common chemical reagent used in the synthesis of 2-aminoquinolines as potent and selective inhibitors of neuronal nitric oxide synthase for neurodegenrative disorders. References Cinelli, M. et al.: J. Med. Chem., 58, 8694 (2015);

Halogenated derivative of febrifugine; coccidiostat

Mouse monoclonal Episialin antibody

Amylin analogue; helps in the regulation of vblood glucose

Rabbit polyclonal AP3B1 antibody

Rabbit polyclonal Hemoglobin antibody (HRP)

An angiotensin II (Ang-II) receptor antagonist, the sequence of the angiotensin II anti-peptide has been derived from the anti-sense mRNA complementary to the human Ang-II mRNA. The anti-peptide shares 50% sequence homology with Ang-II and acts to inhibit some of Ang-II's biological activities.Ang-II is a key signalling peptide of the renin angiotensin system (RAS), which is involved in regulating blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and is widely studied in relation to lifestyle-related diseases. Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE). ACE removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang II type 1 (AT1) and Ang II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.

Rabbit polyclonal OSR1 antibody

Prostaglandin endoperoxide (TP) receptor antagonist

Bradykinin is a peptide hormone that can be formed from the breakdown of kininogen. It works by binding to specific receptors found on the surface of cells and activating a G-protein coupled receptor. Bradykinin stimulates the secretion of gastric acid, increases the permeability of capillaries in the lungs, and causes contraction of smooth muscle in many organs. Bradykinin also has an important role in regulating blood pressure and heart rate. Des-Arg9-[Leu8]-Bradykinin (D-BK) is a potent inhibitor of this activity and is used as an antihypertensive agent. D-BK prevents the activation of G-proteins by binding to receptors with high affinity and specificity. When it binds to its receptor, it inhibits cyclic AMP production, which leads to decreased cell activity and vasodilation. This inhibition reduces blood pressure by reducing cardiac output and increasing systemic vascular resistance.

Peptide H-YSSLAEAASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSLAEAASK^-OH include the following: Performance characteristics of an FT MS-based workflow for label-free differential MS analysis of human plasma: standards, reproducibility, targeted feature J Sutton , T Richmond, X Shi, M Athanas - PROTEOMICS , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.200780057

4-Methoxyphenyl 2,3-di-O-benzyl-4,6-O-benzylidene-?-D-glucopyranoside

Mouse monoclonal ID3 antibody

Rat monoclonal CD86 antibody (PE)

Mouse monoclonal HAGHL antibody

Rabbit polyclonal UQCRQ antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNMA1 antibody, catalog no. 70R-5126

Hepatitis C Virus antibody was raised in goat using recombinant NS3 (genotype 1a) as the immunogen.

Hemin porcine

Conjugated Benzoylecgonine-BSA hapten

Peptide H-YEASILTHDSSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YEASILTHDSSIR^-OH include the following: Absolute quantitation of proteins in human blood by multiplexed multiple reaction monitoring mass spectrometry AJ Percy , AG Chambers, CE Parker - Proteomics: Methods and , 2013 - Springerhttps://link.springer.com/protocol/10.1007/978-1-62703-405-0_13

A synthetic peptide for use as a blocking control in assays to test for specificity of B4GALNT3 antibody, catalog no. 70R-7461

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM63A antibody, catalog no. 70R-4312

Peptide H-TPTELAKLVNKRSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPTELAKLVNKRSE-OH include the following: Fermentation of hemp seed proteins leads to formation of peptides that share sequence similarity with human vitamin D-binding protein M Ruggiero , S Pacini - Medical Research and Innovations, 2020 - siriusstore.comhttps://www.siriusstore.com/pdf/MRI-4-170.pdf Significance of hydrophobic and charged sequence similarities in sodium-bile acid cotransporter and vitamin D-binding protein macrophage activating factor IR Zunaid, S Pacini , M Ruggiero - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.03.03.975524.abstract The anabolic effects of vitamin D-binding protein-macrophage activating factor (DBP-MAF) and a novel small peptide on bone GB Schneider, KJ Grecco, FF Safadi - Critical Reviews™in , 2003 - dl.begellhouse.comhttps://www.dl.begellhouse.com/journals/6dbf508d3b17c437,1752ab8067b2922a,0861d5592ae9cd6a.html

CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.

Please enquire for more information about 3-Sulfanylbutan-1-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page

15-Acetoxyscirpenol