Biochemicals and Reagents

PDGFD is a potent inhibitor of protein interactions. PDGFD has been shown to inhibit the interaction between Kv1.2 and its ligand, as well as inhibit the activation of potassium channels by ATP. PDGFD has also been used in research as a tool to study receptor-ligand interactions and ion channels. This product is a recombinant human protein that has been expressed in E. coli cells with an N-terminal hexahistidine tag for easy purification, and is >95% pure.

Anti-CD2 monoclonal antibody, potential psoriasis treatment, immunomodulatory effects

TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK

CPS1 antibody was raised in Rabbit using Human CPS1 as the immunogen

Rabbit polyclonal Pyk2 antibody

Applications 1,2-Dipalmitoyl-sn-glycero-3-phospho-rac-(1-glycerol) forms lipid bilayers. In the high temperature phase, the conformation of the chains is liquid-like. In the low temperature phases, the chains are stiff and parallel and they interdigitate. References Ranck, J., et al.: Biochimica et Biophysica Acta (BBA) - Lipids and Lipid Metabolism, 488, 432 (1977)

?-D-Gal-PEG3-azide tetraacetate

Sheep polyclonal 17a OH Progesterone antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of AFM antibody, catalog no. 70R-8008

Pevonedistat is a novel investigational drug that inhibits the neddylation of proteins. It blocks the enzymatic activity of protein neddylation (protein O-glucosyltransferase) and prevents the addition of a sugar molecule to lysine residues in proteins. Pevonedistat has been shown to be an inhibitor against the mcl-1 protein, which is an important regulator of apoptosis. Pevonedistat also targets energy metabolism pathways and signal transduction pathways, and its pharmacological effects are thought to be due to its ability to inhibit these processes.

Please enquire for more information about Human Recombinant Lung Beta-II Tryptase including the price, delivery time and more detailed product information at the technical inquiry form on this page

FK-506

Human Thyroid Stimulating Hormone

A synthetic peptide for use as a blocking control in assays to test for specificity of ADCY8 antibody, catalog no. 70R-5957

L-Threonine methyl ester hydrochloride is used as a feed and food additive. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Polyclonal SNRP116 antibody

Rabbit polyclonal TRIM28 antibody

Rabbit polyclonal TR10A antibody

Fmoc-Ile-Rink-Amide MBHA Resin is a resin that is used in the synthesis of peptides. It is composed of amino acid building blocks, which are connected to form polymers. The resin is insoluble in water and organic solvents, which makes it suitable for use in peptide synthesis and other applications. Fmoc-Ile-Rink-Amide MBHA Resin can be used as an alternative to polystyrene and polypropylene resins because it has a higher loading capacity and is more stable at high temperatures.

Rabbit polyclonal FOXL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf35 antibody, catalog no. 70R-4192

Please enquire for more information about Galosemide including the price, delivery time and more detailed product information at the technical inquiry form on this page

A humanized IgG1/κ monoclonal antibody targeting CSF-1.

Phosphotransacetylase (from Leuconostoc mesenteroides), ammonium sulfate suspension

PSA antibody was raised in mouse using human PSA from seminal plasma as the immunogen.

H-KSKIGSTENLKHQPGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KSKIGSTENLKHQPGGC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KSKIGSTENLKHQPGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KSKIGSTENLKHQPGGC-OH at the technical inquiry form on this page

TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF570 antibody, catalog no. 70R-8113

Antimicrobial Bronidox powder

HDAC9 is an antibody that has been tagged with GST and is used as a research tool. HDAC9 is an inhibitor of class II HDACs, which are involved in the regulation of gene expression in response to stress. This antibody is also used to study the interactions between HDACs and other proteins such as ion channels and receptors. The active form of this antibody is purified from a rabbit source, and it has been shown to inhibit class II HDACs at low concentrations.

1H-Imidazole-1-15N is a versatile compound that exhibits multiple characteristics and applications in the field of Life Sciences. It acts as a potent inhibitor of cdk4/6, key enzymes involved in cell cycle regulation. Additionally, 1H-Imidazole-1-15N has been found to stimulate hepatocyte growth and enhance the activity of monoclonal antibodies. This compound is also used as a marker or tracer in various research studies. Its unique isotopic composition (15N) makes it ideal for tracking and analyzing biological processes through techniques like mass spectrometry. Furthermore, 1H-Imidazole-1-15N has demonstrated interactions with other important molecules such as phycocyanin, triclosan, racemase, glycine, β-catenin, palbociclib, and epidermal growth factor. The presence of an amide group in its structure enables 1H-Imidazole

Please enquire for more information about IDO-IN-12 including the price, delivery time and more detailed product information at the technical inquiry form on this page

APS/Beta-2-glycoprotein-1 IgG/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about APS/Beta-2-glycoprotein-1 IgG/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

ATP6AP1 antibody was raised in Rabbit using Human ATP6AP1 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Polyclonal B4GALT3 antibody

Peptide Myr-GRTGRRNAI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Myr-GRTGRRNAI-NH2 include the following: Single-domain near-infrared protein provides a scaffold for antigen-dependent fluorescent nanobodies OS Oliinyk, M Baloban , CL Clark, E Carey, S Pletnev - Nature , 2022 - nature.comhttps://www.nature.com/articles/s41592-022-01467-6 Peptide-based substrate and inhibitor studies of serine/threonine protein kinases ME Koszelak - 1998 - search.proquest.comhttps://search.proquest.com/openview/a972f8e48b37621413f8f97d4e2eede0/1?pq-origsite=gscholar&cbl=18750&diss=y Development of new conformationally and topographically constrained p60 (c-src) PTK inhibitors. Solution and solid-phase approaches for the synthesis of delta LJ Alfaro-Lopez - 1999 - search.proquest.comhttps://search.proquest.com/openview/97330cfab4d04931019e276a0dff78de/1?pq-origsite=gscholar&cbl=18750&diss=y Detection of conformational changes along the kinetic pathway of protein kinase A using a catalytic trapping technique J Shaffer, JA Adams - Biochemistry, 1999 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi991109q Development of inhibitors for protein tyrosine kinases FA Al-Obeidi, KS Lam - Oncogene, 2000 - nature.comhttps://www.nature.com/articles/1203926 Protein tyrosine kinases: structure, substrate specificity, and drug discovery FA Al-Obeidi, JJ Wu, KS Lam - Peptide Science, 1998 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0282(1998)47:3%3C197::AID-BIP2%3E3.0.CO;2-H Phosphorylation of NF-κB proteins by cyclic GMP-dependent kinase: A noncanonical pathway to NF-κB activation B He, G F. Weber - European journal of biochemistry, 2003 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1046/j.1432-1033.2003.03574.x

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF167 antibody, catalog no. 70R-8558

Peptide Ac-RPHTDVEKILPKGISC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-RPHTDVEKILPKGISC-NH2 include the following: Synthesis of empty bacterial microcompartments, directed organelle protein incorporation, and evidence of filament-associated organelle movement JB Parsons , S Frank , D Bhella , M Liang, MB Prentice - Molecular cell, 2010 - cell.comhttps://www.cell.com/molecular-cell/pdf/S1097-2765(10)00285-6.pdf

Peptide H-RHHLQDHFLEIDKKNC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RHHLQDHFLEIDKKNC-OH include the following: Nicotinic acid receptor abnormalities in human skin cancer: implications for a role in epidermal differentiation Y Bermudez, CA Benavente , RG Meyer , WR Coyle - PLoS , 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0020487 Nicotinic Acid Receptor Abnormalities in Human Skin Cancer: Implications Y Bermudez, CA Benavente , RG Meyer , WR Coyle - 2011 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=828a3b06a4b999dc09cf72225d7d2653cffe7aad

H-VETVIEAEADSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VETVIEAEADSK-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VETVIEAEADSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VETVIEAEADSK-OH at the technical inquiry form on this page

MRS 4062 triethylammonium is a purinergic receptor agonist that can be used for the treatment of cancer and other conditions. The purinergic receptors are G protein-coupled receptors that bind to adenosine or ATP, which are molecules involved in the regulation of many cellular processes. MRS 4062 triethylammonium acts as a stimulatory agent by binding to the purinergic receptor and stimulating cell proliferation. This drug has been shown to increase levels of interferon in cells, which may be due to its ability to stimulate cell proliferation. MRS 4062 triethylammonium is also a potent antagonist of the A1 receptor, which may be useful for treating chronic pain.

Purified recombinant LAGE3 protein (His tag)

Rabbit Polyclonal AMPK1 antibody (Thr174)

CA 15-3 Grade II (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 Grade II (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.

AFP antibody was raised in mouse using highly pure hAFP from cord serum as the immunogen.

Ibiglustat (L-malic acid) is a drug for the treatment of kidney diseases. It works by preventing the breakdown of fats and proteins in the body, which can lead to kidney failure. Ibiglustat (L-malic acid) also prevents an amino acid called homocysteine from building up in the blood, which can be toxic to the kidneys. Ibiglustat (L-malic acid) is used to treat people with chronic kidney disease who are on dialysis or who have had a kidney transplant.

Mouse monoclonal Treponema pallidum antibody

Methionine-Enkephalin (ME) is a peptide that has been shown to bind to the opioid receptor and inhibit the production of pro-inflammatory cytokines. ME has been shown to have an inhibitory effect on human liver cells, as well as on cultured human epidermal cells. ME may also have a role in epidermal growth factor receptors, which could be related to its anti-inflammatory effects.

Purified native Human MPO protein

H-VPTDPNPQEMVLENV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VPTDPNPQEMVLENV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VPTDPNPQEMVLENV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VPTDPNPQEMVLENV-OH at the technical inquiry form on this page

1-O-Galloyl β-D-glucopyranoside

Purified Native Rabbit GAPDH protein

MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids  DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

MIP1 alpha antibody was raised in mouse using highly pure recombinant human MIP-1 alpha as the immunogen.

Rabbit polyclonal SERPINB6 antibody

CKAP2L antibody was raised in Rabbit using Human CKAP2L as the immunogen

GNL2 antibody was raised in Rabbit using Human GNL2 as the immunogen

Mouse monoclonal NEUROG3 antibody

Rabbit polyclonal Keratin 18 antibody

BXDC1 antibody was raised in mouse using recombinant Human Brix Domain Containing 1 (Bxdc1)

Please enquire for more information about Alpha-methyl-3-(trifluoromethyl)benzeneacetaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page

1-323 amino acids: MGSSHHHHHH SSGLVPRGSH MDSKHQCVKL NDGHFMPVLG FGTYAPPEVP RSKALEVTKL AIEAGFRHID SAHLYNNEEQ VGLAIRSKIA DGSVKREDIF YTSKLWSTFH RPELVRPALE NSLKKAQLDY VDLYLIHSPM SLKPGEELSP TDENGKVIFD IVDLCTTWEA MEKCKDAGLA KSIGVSNFNR RQLEMILNKP GLKYKPVCNQ VECHPYFNRS KLLDFCKSKD IVLVAYSALG SQRDKRWVDP NSPVLLEDPV LCALAKKHKR TPALIALRYQ LQRGVVVLAK SYNEQRIRQN VQVFEFQLTA EDMKAIDGLD RNLHYFNSDS FASHPNYPYS DEY

Factor VIII antibody (FITC) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.

Rabbit Polyclonal LRRC41 antibody

Catalogue peptide; min. 95% purity

Purified recombinant CD7 protein (His tag)

SPRi 3 is a synthetic sepiapterin analogue. It has been shown to be a selective inhibitor of the enzyme aromatic L-amino acid decarboxylase (AADC) in cancer cells and has also shown some antitumour activity. SPRi 3 is able to inhibit the synthesis of monoamine neurotransmitters, which are involved in pain modulation and have been implicated in autoimmune disease pathogenesis. SPRi 3 is also able to activate cardiac tissue and relieve pain caused by inflammation or injury. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside An anti-tuberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been shown

HBsAg antibody is a monoclonal antibody that specifically targets the hepatitis B surface antigen (HBsAg). This antibody is highly activated and has been shown to effectively neutralize HBsAg, preventing its interaction with host cells. It has also demonstrated inhibitory effects on the growth of cancer cells, such as MCF-7 breast cancer cells. In addition, this antibody has potential applications in autoimmune diseases, as it can bind to autoantibodies and inhibit their activity. The HBsAg antibody can be used as a research tool in various life science disciplines, including immunology and virology. It can also be utilized in diagnostic assays for the detection of HBsAg or as a therapeutic agent for targeted delivery of active agents. With its high specificity and binding affinity, this monoclonal antibody holds great promise in advancing scientific understanding and medical advancements in the field of hepatitis B and beyond.

The PARP9 antibody is a glycoprotein that targets telomerase and has been widely used in Life Sciences research. This antibody specifically recognizes PARP9, a protein kinase involved in various cellular processes. It has been shown to be effective in neutralizing atypical hemolytic antibodies and can be used for nuclear staining. The PARP9 antibody is commonly used in experiments involving alpha-fetoprotein detection in human serum samples. Additionally, it has been utilized in studies investigating the effects of taxol on cellular signaling pathways. With its high specificity and sensitivity, this antibody is an essential tool for researchers in the field of Life Sciences.

Rabbit polyclonal VIPR1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf66 antibody, catalog no. 70R-8731

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A38 antibody, catalog no. 70R-6469

ELISA kit for the detection of Sperm Antibodies in the research laboratory

VWF antibody (biotin) was raised in goat using human vWF purified from plasma as the immunogen.

Peptide H-SLWNWFDITKWLWYIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLWNWFDITKWLWYIK-OH include the following: The binding of HIV-1 gp41 membrane proximal domain to its mucosal receptor, galactosyl ceramide, is structure-dependent H Yu, A Alfsen, D Tudor , M Bomsel - Cell calcium, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0143416007000838

A synthetic peptide for use as a blocking control in assays to test for specificity of UXT antibody, catalog no. 70R-1211

Amphotericin B is an antifungal agent that belongs to a class of polyenes. It binds to ergosterol in fungal cell membranes and alters their permeability, thereby causing leakage of cellular contents. Amphotericin B methyl ester is a water-soluble prodrug form of amphotericin B that has been shown to have anti-infective activity against many types of fungi, including Candida albicans, Trichosporon beigelii, and Aspergillus fumigatus. Amphotericin B methyl ester has also been shown to be effective against some bacteria such as Streptococcus pneumoniae, Haemophilus influenzae, and Mycoplasma pneumoniae. In vitro studies have demonstrated the detection sensitivity of amphotericin B methyl ester for Coccidioides immitis at 1 ng/ml or less. Amphotericin B methyl ester does not exhibit any hemolytic activity even at concentrations

Mouse monoclonal OBFC2B antibody

Purified recombinant Human UXT protein (His tag)

Rabbit polyclonal cAbl antibody

Rabbit polyclonal MRCKB antibody

Non-selective monoamine transporter inhibitor

L-Lysine hydrochloride

Peptide H-TIHDIILECV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TIHDIILECV-OH include the following: Novel Canonical and Non-Canonical Antigens That Extend Current Targets for Immunotherapy of HPV-Driven Cervical Cancer X Peng, I Woodhouse , G Hancock, R Parker - Available at SSRN - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=4022700 Novel canonical and non-canonical viral antigens extend current targets for immunotherapy of HPV-driven cervical cancer X Peng, I Woodhouse , G Hancock, R Parker, K Marx - Iscience, 2023 - cell.comhttps://www.cell.com/iscience/pdf/S2589-0042(23)00178-5.pdf Activation of CD40 in cervical carcinoma cells facilitates CTL responses and augments chemotherapy-induced apoptosis SC Hill, SJ Youde, S Man, GR Teale - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/174/1/41/72267 Development of a spontaneous HPV16 E6/E7-expressing head and neck squamous cell carcinoma in HLA-A2 transgenic mice S Peng , D Xing , L Ferrall , YC Tsai, RBS Roden - MBio, 2022 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/mbio.03252-21 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells RJ Stanton , V Prod'homme, MA Purbhoo, M Moore - Cell host & , 2014 - cell.comhttps://www.cell.com/cell-host-microbe/pdf/S1931-3128(14)00259-5.pdf How mass spectrometric interrogation of MHC class I ligandomes has advanced our understanding of immune responses to viruses N Ternette , E Adamopoulou, AW Purcell - Seminars in Immunology, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1044532323000714 Defined flanking spacers and enhanced proteolysis is essential for eradication of established tumors by an epitope string DNA vaccine MP Velders, S Weijzen, GL Eiben - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/9/5366/108349 Development of a human cytomegalovirus (HCMV)-based therapeutic cancer vaccine uncovers a previously unsuspected viral block of MHC class I antigen MO Abdelaziz, S Ossmann, AM Kaufmann - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2019.01776/full Early protective effect of a ("œpan") coronavirus vaccine (PanCoVac) in Roborovski dwarf hamsters after single-low dose intranasal administration MO Abdelaziz, MJ Raftery, J Weihs - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1166765/full Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone KH Kim, R Dishongh, AD Santin, MJ Cannon - Cancer Immunity, 2006 - AACRhttps://aacrjournals.org/cancerimmun/article-abstract/6/1/9/472052 Oxidative stress can alter the antigenicity of immunodominant peptides D Weiskopf , A Schwanninger - Journal of leukocyte , 2010 - academic.oup.comhttps://academic.oup.com/jleukbio/article-abstract/87/1/165/6959842 Induction of cytotoxic T lymphocytes with dendritic cells transfected with human papillomavirus E6 and E7 RNA: implications for cervical cancer immunotherapy C Thornburg, D Boczkowski, E Gilboa - Journal of , 2000 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2000/07000/induction_of_cytotoxic_t_lymphocytes_with.4.aspx

NSC43067 is a class of kinase inhibitors that are designed to inhibit the activity of cyclin-dependent kinases. Cyclin-dependent kinases are enzymes that regulate the progression of cells through the cell cycle by phosphorylating key substrates. NSC43067 binds to the ATP binding site of these enzymes and blocks their activity, thereby inhibiting cell division. This drug has been shown to be effective against some tumors and leukemia cells in vitro. In addition, it also has antiviral effects against HIV-1 protease and influenza virus neuraminidase.>

Pigment Red 32 is an organic pigment that is soluble in propylene glycol and surface-active agents. It has a particle diameter of about 0.1 microns and an average particle size of 0.2 microns, with a maximum of 100% dispersion in water. Pigment Red 32 has been shown to be acidic, fluorescent, thiophosphoric, non-polar, styrene-based, and organic solvent-soluble. This pigment is used in the production of plastics and paints for devices such as TV screens due to its ability to liquefy under radiation or heat. Pigment Red 32 also contains functional groups that impart both hydrophobic and hydrophilic properties to the molecule.br>br> Pigment Red 32 can be found in paint products including acrylics, alkyds, latexes, oil paints, and watercolors.br>br> Pigment Red 32 can be found in plastics products including ABS res

Peptide H-MGKKQNRKTGNSKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MGKKQNRKTGNSKTC-NH2 include the following: Discovery of the Long Interspersed Nuclear Element-1 activation product [Open Reading Frame-1 (ORF1) protein] in human blood K Hosseinnejad, T Yin, JT Gaskins, JL Bailen - Clinica Chimica , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898118305266

A synthetic peptide for use as a blocking control in assays to test for specificity of Fto antibody, catalog no. 70R-8687

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

DAAM1 antibody was raised in Rabbit using Human DAAM1 as the immunogen

E. coli antibody (biotin) was raised in rabbit using mixtures of all antigenic serotypes as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of RPA4 antibody, catalog no. 70R-5578

195-308 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMARA RNGDHCPLGP GRCCRLHTVR ASLEDLGWAD WVLSPREVQV TMCIGACPSQ FRAANMHAQI KTSLHRLKPD TVPAPCCVPA SYNPMVLIQK TDTGVSLQTY DDLLAKDCHC I

Peptide H-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AYEQNPQHFIEDLEK-OH include the following: Mapping Protective Epitopes for Anthrax and Plague Vaccine Antigens by LC-MS/MS BS Powell, JT Enama, SF Little, S Trevino - Biology Using Peptides , 2006 - Springerhttps://link.springer.com/content/pdf/10.1007/978-0-387-26575-9_307.pdf

Angiotensin II receptor antagonist

Rabbit polyclonal Casein kinase 2 antibody (FITC)

MRAP antibody was raised in Rabbit using Human MRAP as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TAF3 antibody, catalog no. 70R-9077

A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C68 antibody, catalog no. 70R-6774

AZ 1729 is a peptide that has been shown to act as an activator for ion channels and receptors. It is used as a research tool in cell biology, pharmacology, and protein interactions. The CAS number for AZ 1729 is 2016864-46-1.

GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-PQPEQPFPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PQPEQPFPW-OH include the following: Affinity-engineered human antibodies detect celiac disease gluten pMHC complexes and inhibit T-cell activation R Frick, LS Hoydahl , I Hodnebrug, S Kumari - bioRxiv, 2019 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/840561.abstract Characterisation of clinical and immune reactivity to barley and rye ingestion in children with coeliac disease MY Hardy, AK Russell, C Pizzey, CM Jones - Gut, 2020 - gut.bmj.comhttps://gut.bmj.com/content/69/5/830.abstract Reducing the incidence of allergy and intolerance to cereals LJWJ Gilissen, IM van der Meer - Journal of Cereal Science, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0733521014000174 Comprehensive, quantitative mapping of T cell epitopes in gluten in celiac disease JA Tye-Din, JA Stewart, JA Dromey - Science translational , 2010 - science.orghttps://www.science.org/doi/abs/10.1126/scitranslmed.3001012

Rabbit polyclonal RPS20 antibody

Chicken IgY precipitation reagent for use in immunoassays

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.

Please enquire for more information about L-Alpha-glycerophosphoryleth anolae including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-GLEWVGAIYPGNGDTSYNQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLEWVGAIYPGNGDTSYNQK-OH include the following: A Liquid Chromatography-Tandem Mass Spectrometry Method for Determination of Ocrelizumab in Serum of Patients with Multiple Sclerosis P Matlak, H Brozmanova, P Sistik, D Moskorova - Available at SSRN - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=4861160 Ocrelizumab quantitation by liquid chromatography-tandem mass spectrometry EI Hallin , TT Serkland, KM Myhr , aca˜ Torkildsen - Journal of Mass , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2667145X22000220

C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogen

IL21 antibody was raised in rabbit using highly pure recombinant murine IL-21 as the immunogen.

H-AVTFCFASSQNITEE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AVTFCFASSQNITEE-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AVTFCFASSQNITEE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AVTFCFASSQNITEE-OH at the technical inquiry form on this page

Lanifibranor is a drug that has been shown to lower systolic pressure in diabetic patients. It is an antidiabetic agent that blocks the synthesis of fatty acids and triglycerides by inhibiting the enzyme protein kinase C (PKC). Lanifibranor has been shown to decrease the levels of fibrosis and cell nuclei, as well as decrease the proliferation of cells in culture. This drug also lowers body mass index and improves metabolic disorders in diabetic patients. Lanifibranor inhibits PKC, which leads to a reduction in primary cells such as liver cells and fibroblasts, thereby decreasing inflammation and oxidative stress. This drug is currently undergoing clinical trials for use in autoimmune diseases like celiac disease.

Rabbit polyclonal GM2A antibody (biotin)

Mouse monoclonal CD4 (T-cell receptor) antibody (FITC)

Pigment Orange 36 is an organic pigment with a light-emitting property. It is soluble in organic solvents, such as benzene and chloroform, but insoluble in water. Pigment Orange 36 has a polycyclic aromatic hydrocarbon structure with ester linkages between the aliphatic hydrocarbon and aromatic hydrocarbon moieties. The molecule consists of two sections: one section is soluble in organic solvents and the other section is soluble in water. The particle size of Pigment Orange 36 ranges from 0.1 to 1 micron in diameter, and it emits light when excited by UV radiation or visible light.

Flt1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Peptide H-AVEPQLEDDER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVEPQLEDDER-OH include the following: A novel role for GalNAc-T2 dependent glycosylation in energy homeostasis CRC Verzijl, F Oldoni , N Loaiza, JC Wolters - Molecular , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212877822000412

Rabbit polyclonal GABRB1 antibody

Peptide H-VATEFSETAPATLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VATEFSETAPATLK^-OH include the following: Large-Scale Quantitative Proteomic Study of PUMA-Induced Apoptosis Using Two-Dimensional Liquid Chromatography-Mass Spectrometry Coupled with Amino S Gu, Y Du, J Chen, Z Liu, EM Bradbury - Journal of Proteome , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr049893a Prediction of hopeless peptides unlikely to be selected for targeted proteome analysis F Matsuda , A Tomita, H Shimizu - Mass Spectrometry, 2017 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/massspectrometry/6/1/6_A0056/_article/-char/ja/

H-CGGSSHHHHHHSSGLVPRGS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGSSHHHHHHSSGLVPRGS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGSSHHHHHHSSGLVPRGS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGSSHHHHHHSSGLVPRGS-OH at the technical inquiry form on this page

Purified recombinant Bovine IFN-Tau protein (Bovine)

Rabbit polyclonal MEF2B antibody

CLYBL antibody was raised in Rabbit using Human CLYBL as the immunogen

Z-Leu-Arg-Gly-Gly-AMC is a peptide inhibitor of the human Kv2.1 potassium channel. It has been shown to inhibit current in Xenopus oocytes expressing Kv2.1 channels at concentrations of 10 μM and lower. Z-Leu-Arg-Gly-Gly-AMC can be used as a research tool or an antibody to study cell biology, protein interactions, and receptor functions.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rotavirus antibody was raised in goat using nebraska calf diarrhea virus as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SPINK1 antibody, catalog no. 70R-5308

4-Methoxyphenylazoformyl-Phe is a synthetic molecule that can be used as a research tool in the study of ion channels and ligands. The receptor binding affinity of 4-methoxyphenylazoformyl-Phe is unknown, but it has been shown to activate peptides in living cells. This compound is an inhibitor of ion channels and ligand for G protein coupled receptors. It can be used as a research tool in the study of ion channels and ligands. The receptor binding affinity of 4-methoxyphenylazoformyl-Phe is unknown, but it has been shown to activate peptides in living cells. This compound is an inhibitor of ion channels and ligand for G protein coupled receptors.

Peptide H-ALQQIMENQSDRLQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALQQIMENQSDRLQG-OH include the following: IgE and IgG4 epitope mapping by microarray immunoassay reveals the diversity of immune response to the peanut allergen, Ara h 2 WG Shreffler , DA Lencer, L Bardina - Journal of Allergy and , 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674905016398