Biochemicals and Reagents

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal Insulin antibody

Catalogue peptide; min. 95% purity

RAB14 antibody was raised in rabbit using the C terminal of RAB14 as the immunogen

FRK antibody was raised in Mouse using a purified recombinant fragment of FRK(aa2-300) expressed in E. coli as the immunogen.

TSKS antibody was raised using the middle region of TSKS corresponding to a region with amino acids ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS

PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Custom research peptide; min purity 95%.

Purified Polyclonal UBR2 antibody

Peptide H-SHCIAEVENDEMPADLPSLAADFVESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SHCIAEVENDEMPADLPSLAADFVESK-OH include the following: HMMatch: peptide identification by spectral matching of tandem mass spectra using hidden Markov models X Wu, CW Tseng, N Edwards - Journal of Computational biology, 2007 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/cmb.2007.0071 An EThcD-based method for discrimination of leucine and isoleucine residues in tryptic peptides SS Zhokhov, SV Kovalyov, TY Samgina - Journal of The , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-017-1674-3 Glycation of glucose sensitive lysine residues K36, K438 and K549 of albumin is associated with prediabetes R Rathore, BP Sonwane , MG Jagadeeshaprasad - Journal of , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391919302532

N-[2-[[[1-[[(4-Fluorophenyl)amino]carbonyl]cyclopropyl]carbonyl]amino]ethyl]-2-methylene-3-oxoolean-12-en-28-amide is a research tool for the study of protein interactions and the development of new drugs. It has shown to be a potent inhibitor of ion channels, including voltage gated sodium channels. This compound binds to the extracellular domain of these channels and prevents activation, leading to inhibition of nerve impulse transmission. N-[2-[[[1-[[(4-Fluorophenyl)amino]carbonyl]cyclopropyl]carbonyl]amino]ethyl]-2-methylene-3-oxoolean-12-en-28 amide also inhibits ligand binding to its receptor by binding in an allosteric site that is distinct from the active site.

Factor B antibody was raised in Mouse using purified factor B from human blood as the immunogen.

Purified recombinant Human DNAJB6 protein

Rabbit polyclonal NDUFA1 antibody

H-AENAGNDAC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AENAGNDAC-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AENAGNDAC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AENAGNDAC-OH at the technical inquiry form on this page

ELISA kit for the detection of ENA in the research laboratory

Peptide H-VFDNFVLKIRDTKKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VFDNFVLKIRDTKKQ-OH include the following: Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin MLT Mercado, A Nur-e-Kamal, HY Liu - Journal of , 2004 - Soc Neurosciencehttps://www.jneurosci.org/content/24/1/238.short Three-dimensional nanofibrillar surfaces covalently modified with tenascin-C-derived peptides enhance neuronal growth in vitro I Ahmed, HY Liu, PC Mamiya , AS Ponery - Research Part A: An , 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jbm.a.30587

Catalogue peptide; min. 95% purity

Peptide H-VAVEEVDEEGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VAVEEVDEEGK^-OH include the following: Quantitative proteomics using 16O/18O labeling and linear ion trap mass spectrometry D Lopez-Ferrer , A Ramos-Fernandez - , 2006 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200500375

Please enquire for more information about Suc-Ile-Glu(γ-pip)-Gly-Arg-pna hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

CP 1282 is a DNA glycosylase that inactivates DNA. It binds to the guanine residue, which has been activated by the removal of an amino group and a phosphate group, and catalyzes the hydrolysis of the glycosidic bond between the deoxyribose sugar and the base. CP 1282 can be used to repair damaged DNA or detect specific sequences. It has been shown to have high efficiencies for transversions and is able to activate efficiently in assays. CP 1282 also has a programmable strategy that can be manipulated according to a desired molecule, such as dna binding protein or glycosylase. This molecule also has specificities and frequencies for different sequences, which can be used as strategies for detecting specific sequences in dna.

ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF699 antibody, catalog no. 70R-9018

RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKT

The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.

FZD5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM12 antibody, catalog no. 70R-5031

Applications Erucic acid is a long-chain alcohol that acts as an inhibitor of fatty acid oxidation in the heart. Erucic acid originates in rapeseed plants, and is the major fatty acid constituent of rapeseed plant oil extracts and canola oil. References Christophersen, B. & Bremer, J.: BBA-Lipid. Lipid Met., 280, 506 (1972); Ecke, W., et al.: Theor. Appl. Gen., 91, 972 (1995); Metz, J., et al.: Plant Phys., 122, 635 (2000)

Please enquire for more information about PC945 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal PDXDC1 antibody

Peptide H-SFKAALSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFKAALSSL-OH include the following: Ebola virus inactivation with preservation of antigenic and structural integrity by a photoinducible alkylating agent KL Warfield , DL Swenson, GG Olinger - The Journal of , 2007 - academic.oup.comhttps://academic.oup.com/jid/article-abstract/196/Supplement_2/S276/860033

E-64-c is a research tool that is used to activate the receptor of a cell. This ligand can bind to the receptor and form a complex, which will then be able to interact with other proteins in the cell. This process can lead to changes in ion channel activity, protein synthesis, or gene expression. E-64-c has been shown to inhibit the activity of ion channels such as calcium channels and potassium channels, as well as protein synthesis. It also binds to antibodies and blocks their binding sites on cells.br> E-64-c is a high purity ligand that can be used for studying protein interactions or pharmacological purposes. The potency of this ligand has been tested by measuring its ability to inhibit the binding of various peptides such as vasopressin and angiotensin II.

Mouse monoclonal SulT2A1 antibody

Bodipy-palmitate is a medicinal compound that has been shown to have potent anticancer properties. It is an analog of the Chinese herbal medicine, berberine, which has been used for centuries as a traditional remedy for various ailments. Bodipy-palmitate inhibits tumor growth by inducing apoptosis in cancer cells and inhibiting kinase activity. This compound has been shown to be effective against a variety of human cancers and has potential as a novel therapeutic agent in the treatment of cancer. In addition, Bodipy-palmitate can be detected in urine and can serve as a biomarker for the presence of inhibitors of protein kinases.

Metabolite of mephenytoin

Affinity purified Rabbit polyclonal DNAJC7 antibody

H-IDFSHQGPAFVTWHR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IDFSHQGPAFVTWHR-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IDFSHQGPAFVTWHR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IDFSHQGPAFVTWHR-OH at the technical inquiry form on this page

Rabbit polyclonal SH3D19 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of REEP4 antibody, catalog no. 70R-7356

AURKA antibody was raised in rabbit using the C terminal of AURKA as the immunogen

Please enquire for more information about Pan Plasmodium Aldolase Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-CEKMIEVVEEIDSIPSLPNLT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CEKMIEVVEEIDSIPSLPNLT-OH include the following: The mitochondrial metallochaperone SCO1 maintains CTR1 at the plasma membrane to preserve copper homeostasis in the murine heart ZN Baker, K Jett, A Boulet, A Hossain - Human molecular , 2017 - academic.oup.comhttps://academic.oup.com/hmg/article-abstract/26/23/4617/4103405

Purified recombinant Human CCL1 protein

The TRPM4 antibody is a high-quality monoclonal antibody that specifically targets the TRPM4 protein. This antibody is widely used in life sciences research and has been shown to have excellent specificity and sensitivity. It binds to the carbonyl group of the TRPM4 protein, inhibiting its activity and preventing downstream signaling pathways. In addition to its role in research, the TRPM4 antibody has potential therapeutic applications. It has been investigated as a potential treatment for various diseases, including cancer and autoimmune disorders. The antibody's ability to target specific proteins makes it an ideal candidate for targeted therapy. Furthermore, the TRPM4 antibody has been extensively validated in various experimental settings. It has been tested in Western blotting, immunohistochemistry, flow cytometry, and other techniques commonly used in life sciences research. Its specificity and reliability make it a valuable tool for scientists studying the TRPM4 protein and its associated pathways. Overall, the TRPM4 antibody is a highly effective tool for researchers

Armenian Hamster monoclonal CD11c antibody (allophycocyanin)

Rabbit polyclonal MEGF8 antibody

TAS-115 mesylate is a research tool that can be used to activate receptors. It is a ligand with the chemical name of N-[(3R)-3-[[[2-(3,4-Dichlorophenyl)ethyl]amino]methyl]-4-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl]benzamide mesylate. TAS-115 mesylate binds to cell surface receptors and activates them by increasing the permeability of ion channels in cells. This compound has also been shown to inhibit protein interactions and peptide synthesis. TAS-115 mesylate is a high purity product that does not contain any impurities or other chemicals that might interfere with results from experiments.

Peptide H-NLCNIPCSALLSSDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NLCNIPCSALLSSDI-OH include the following: Requirement for association of p56lck with CD4 in antigen-specific signal transduction in T cells N Glaichenhaus, N Shastri, DR Littman , JM Turner - Cell, 1991 - cell.comhttps://www.cell.com/cell/pdf/0092-8674(91)90235-Q.pdf Role of a C-terminal residue of an immunodominant epitope in T cell activation and repertoire diversity. JA Mikszta, YS Jang, BS Kim - Journal of immunology (Baltimore , 1997 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/158/1/127/30093 Processing and reactivity of T cell epitopes containing two cysteine residues from hen egg-white lysozyme (HEL74-90) HK Kang, JA Mikszta, H Deng, EE Sercarz - The Journal of , 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/4/1775/69908

Peptide H-VVIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVIT-OH include the following: Intramitochondrial Localization of the Main 70-kDa Heat-Shock Cognate Protein in Drosophila Cells TN INTRODUCTI - 1993 - academia.eduhttps://www.academia.edu/download/67763721/excr.1993.119720210626-10561-1nf0y8x.pdf Integrin activation by regulated oligomerization of PECAM-1 from within the cell T Zhao - 2001 - search.proquest.comhttps://search.proquest.com/openview/6ba1e371c861e7ad53fdaf8f87407358/1?pq-origsite=gscholar&cbl=18750&diss=y A systematic approach to the comparison of protein structures SJ Remington , BW Matthews - Journal of Molecular Biology, 1980 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0022283680903575 Astrovirus replication: an overview S Guix , A Bosch , RM Pinto - -Based Study Of Viral Replication: (With , 2008 - World Scientifichttps://www.worldscientific.com/doi/abs/10.1142/9789812790859_0022 Growth and Development: ADSA-Mammary Development-The Role of Progenitor Cells and Nutritional Modulation on Lactation S Ellis, BE Etchebarne , M Kiupel - Poultry , 2004 - search.proquest.comhttps://search.proquest.com/openview/a513e711b452749b7a888fe74e151b5c/1?pq-origsite=gscholar&cbl=48306 Structure of egg yolk very low density lipoprotein. Polydispersity of the very low density lipoprotein and the role of lipovitellenin in the structure RJ Evans, DH Bauer, SL Bandemer, SB Vaghefi - Archives of biochemistry , 1973 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0003986173900015 The cloning and characterization ofquaking: A gene essential in embryogenesis and myelination Q Chen - 1995 - search.proquest.comhttps://search.proquest.com/openview/6ded411b0520aeee05d387d6e143e885/1?pq-origsite=gscholar&cbl=18750&diss=y Differential regulation of carbonic anhydrase II by androgen and estrogen in dorsal and lateral prostate of the rat PL Haca„RKaca–NEN , SI Maca„KELaca„, EM VALVE - , 1991 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/128/6/3219/2535360 Maintenance of adult rat ventral prostate in organ culture P Martikainen - The Anatomical Record, 1987 - Wiley Online Libraryhttps://anatomypubs.onlinelibrary.wiley.com/doi/abs/10.1002/ar.1092180212 Affinity labeling of the active site of Staphylococcal nuclease: Reactions with bromoacetylated substrate analogues P Cuatrecasas, M Wilchek, CB Anfinsen - Journal of Biological Chemistry, 1969 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)94322-X/abstract Sexually dimorphic expression of pituitary growth hormone-releasing factor receptor in the rat M Ono, N Miki, Y Murata, E Osaki, K Tamitsu - Biochemical and , 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X85727283 Mutations in the coat protein of a begomovirus result in altered transmission by different species of whitefly vectors LL Pan, Y Chi, C Liu, YY Fan, SS Liu - Virus Evolution, 2020 - academic.oup.comhttps://academic.oup.com/ve/article-abstract/6/1/veaa014/5780092 The chemistry of insulin H Jensen, EA Evans Jr - Physiological Reviews, 1934 - journals.physiology.orghttps://journals.physiology.org/doi/pdf/10.1152/physrev.1934.14.2.188 Intramitochondrial localization of the main 70-kDa heat-shock cognate protein in Drosophila cells EM Carbajal, JF Beaulieu , LM Nicole - Experimental cell , 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014482783711973 The role of epidermal cytokines in inflammatory skin diseases. DN Sauder - Journal of investigative Dermatology, 1990 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=0022202X&AN=12505705&h=kD0ausxwo1%2BtR7W%2FyNMh%2Fnw9VjK%2BeQruibfTAjidKzxQZru3nxK7Q8Qq28LpkPfjMn0Ja8LYugBOGCTH99RYbg%3D%3D&crl=c Prediction of initiation sites for protein folding with oi-helix preferences D IURETIC - Periodicum biologorum, 1999 - splitbioinf.pmfst.hrhttp://splitbioinf.pmfst.hr/split/4/doc/predict._of_init._sites_for_prot._folding_with_aplha-helix_pref..pdf Nonsteroidal anti-inflammatory drugs impair oral mucosal repair by eliciting disturbances in endothelin-converting enzyme-1 and constitutive nitric oxide synthase BL Slomiany, A Slomiany - Journal of Physiology and , 2001 - agro.icm.edu.plhttps://agro.icm.edu.pl/agro/element/bwmeta1.element.agro-article-f598802a-7a23-46a0-b629-d2f072095347 Stem-Loop Structure Synergy in Binding Cellular Proteins to the 5'| Noncoding Region of Poliovirus RNA AA Haller, BL Semler - Virology, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S004268228571015X

N-[(E,2S,3R)-1,3-Dihydroxyoctadec-4-en-2-yl]triacontanamide is a complex lipid molecule, which is typically synthesized or isolated from biological sources such as plant or animal lipids. This compound belongs to a class of fatty acid conjugates known for their structural complexity and biological activities. The source of this compound often includes lipid-rich tissues or organisms where long-chain amides play structural or signaling roles. Its mode of action involves interacting with cellular lipid membranes, potentially affecting membrane fluidity and signaling pathways. This interaction may influence various cellular processes, including lipid metabolism, signal transduction, and membrane dynamics. Applications of N-[(E,2S,3R)-1,3-Dihydroxyoctadec-4-en-2-yl]triacontanamide are primarily in biochemical and pharmacological research. It is used to study lipid metabolism, signal transduction pathways, and possibly in the formulation of therapeutic agents targeting metabolic disorders. Its complex structure and unique properties make it a subject of interest for researchers exploring novel lipid interactions and their implications in health and disease.

NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM59L antibody, catalog no. 70R-1898

Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page

Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt-Akt1, Akt2, and Akt3-each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.

A synthetic peptide for use as a blocking control in assays to test for specificity of NR3C2 antibody, catalog no. 70R-1003

Interdigitating cell antibody was raised in mouse using rat peritoneal macrophages as the immunogen.

Peptide LCBiot-NTKNHPMLMNLLKDNPAQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-NTKNHPMLMNLLKDNPAQD-OH include the following: Structure-function analysis of 1-hydroxypioglitazone, a major in vivo metabolite of the PPARγ agonist pioglitazone SA Mosure, J Shang , R Brust , J Zheng , PR Griffin - bioRxiv, 2018 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/351346.abstract Structural basis of altered potency and efficacy displayed by a major in vivo metabolite of the antidiabetic PPARγ drug pioglitazone SA Mosure, J Shang , J Eberhardt , R Brust - Journal of medicinal , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.8b01573

Please enquire for more information about Pivalaldehyde-d9 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Annexin V Apoptosis Kit for detection of apoptosis in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of ICA1L antibody, catalog no. 70R-4147

Peptide Ac-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-TASSYFTNMFATWSPSKARL-NH2 include the following: Neutralizing antibodies against factor VIII can occur through a non-germinal center pathway SR Patel , TS Lundgren, WH Baldwin, C Cox - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2022.880829/full

L-Glutamic acid γ-(7-amido-4-methylcoumarin)

Recombinant human CXCL11 protein (His tag)

Rabbit polyclonal ICAM1 antibody (Tyr512)

A synthetic peptide for use as a blocking control in assays to test for specificity of B4GALT2 antibody, catalog no. 70R-6780

H-NTRPPLGDWF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NTRPPLGDWF-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NTRPPLGDWF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NTRPPLGDWF-OH at the technical inquiry form on this page

H-CGGAEYHA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGAEYHA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGAEYHA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGAEYHA-OH at the technical inquiry form on this page

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and HPLC.

P63, GST tagged human, is a recombinant protein, which is derived from human sources. This product features a glutathione S-transferase (GST) tag, facilitating its purification and use in various experimental settings. The mechanism of action involves the P63 protein, which plays a crucial role in the regulation of gene expression, cellular development, and apoptosis, fused with the GST tag that enables straightforward purification via affinity chromatography. The primary uses and applications of P63, GST tagged human, are in cellular and molecular biology research. It is employed to study the functions and interactions of the p63 protein in cellular processes, aiding in elucidating its role in development and cancer biology. Researchers utilize this tagged protein to explore protein-protein interactions, as the GST tag not only assists in isolation but also in detecting proteins in Western blot assays. Additionally, it serves as a valuable tool in structural biology for protein crystallization studies.

H-KRQISIATFTVQAAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRQISIATFTVQAAA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRQISIATFTVQAAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRQISIATFTVQAAA-OH at the technical inquiry form on this page

The p53 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It has been developed to specifically target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. The p53 antibody is designed to recognize and bind to the p53 protein in human serum samples, as well as in tissue sections. It has been extensively validated for its specificity and sensitivity, ensuring accurate and reliable results. By using this antibody, researchers can gain valuable insights into the function and regulation of the p53 pathway, which is essential for understanding cancer development and progression. In addition to its application in cancer research, the p53 antibody has also shown potential in other areas of study. For example, it has been used to investigate the role of p53 in apoptosis (programmed cell death) by detecting its interaction

Sheep Serum Albumin is a high-quality glycoprotein that is commonly used in the field of Life Sciences. This native protein exhibits excellent neutralizing properties and can be used for various applications such as the production of monoclonal antibodies or as a plasticizer in collagen-based materials. Sheep Serum Albumin is known for its histidine-rich composition, which makes it an ideal choice for research involving intraocular studies or neuroprotective investigations. With its high polymer structure and resistance to denaturation, this glycosylated protein ensures long-lasting stability and reliable results in experiments. Trust Sheep Serum Albumin for your research needs and unlock new possibilities in the world of Proteins and Antigens.

α-cyclodextrin

The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (261-275) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

Mouse monoclonal Cytokeratin 10 antibody

Peptide H-VPYGSFKHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VPYGSFKHV-OH include the following: The Final N-Terminal Trimming of SPC HLA - J Immunol, 2002 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=3fcdbf53fcf0fea74f35206a45a0835c6d9d0946 Processing of some antigens by the standard proteasome but not by the immunoproteasome results in poor presentation by dendritic cells S Morel, F Levy, O Burlet-Schiltz, F Brasseur - Immunity, 2000 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(00)80163-6.pdf The cytoplasmic peptidase DPP9 is rate-limiting for degradation of proline-containing peptides R Geiss-Friedlander , N Parmentier, U Möller - Journal of biological , 2009 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)38389-7/abstract 264 MASS SPECTROMETRY: MODIFIED PROTEINS AND GLYCOCONJUGATES [11] O BURLET-SCHILTZ - : Modified Proteins and , 2005 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=jFpnZTmZmngC&oi=fnd&pg=PA264&dq=(%22H-VPYGSFKHV-OH%22+OR+%22NH2-Val-Pro-Tyr-Gly-Ser-Phe-Lys-His-Val-OH%22+OR+%22VPYGSFKHV%22)+AND+peptide&ots=tXWYLrsQ6-&sig=z1dz1Gd_AFhQBSOt9RzCSxeq7Fw The use of mass spectrometry to identify antigens from proteasome processing O Burlet-Schiltz, S Claverol, JE Gairin - Methods in Enzymology, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687905050111 A recyclable assay to analyze the NH2-terminal trimming of antigenic peptide precursors L Burri, C Servis, L Chapatte, F Levy - Protein expression and purification, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592802005077 Preclinical development of dipeptidyl peptidase IV inhibitor alogliptin: a brief overview KVL Parsa , M Pal - Expert Opinion on Drug Discovery, 2011 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1517/17460441.2011.588695 Immunoproteasome down-modulation enhances the ability of dendritic cells to stimulate antitumor immunity J Dannull, DT Lesher, R Holzknecht - Blood, The Journal , 2007 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/110/13/4341/103257 Advances in understanding the expression and function of dipeptidyl peptidase 8 and 9 H Zhang , Y Chen, FM Keane, MD Gorrell - Molecular Cancer Research, 2013 - AACRhttps://aacrjournals.org/mcr/article-abstract/11/12/1487/89283 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9 E Pilla, M Kilisch, C Lenz , H Urlaub - Journal of Biological , 2013 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)48610-7/abstract Puromycin-sensitive aminopeptidase limits MHC class I presentation in dendritic cells but does not affect CD8 T cell responses during viral infections CF Towne, IA York , J Neijssen , ML Karow - The Journal of , 2008 - journals.aai.orghttps://journals.aai.org/jimmunol/article/180/3/1704/75825 New insights into the role of dipeptidyl peptidase 8 and dipeptidyl peptidase 9 and their inhibitors C Cui, X Tian , L Wei, Y Wang, K Wang - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fphar.2022.1002871/full

A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN18 antibody, catalog no. 70R-6931

Please enquire for more information about Arachidonic acid-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page

TBC1D10A antibody was raised in rabbit using the C terminal of TBC1D10A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA3 antibody, catalog no. 70R-5915

A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 20R-1259

Peptide H-VGLPISQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGLPISQR^-OH include the following: Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry SM Prezioso, AJ Carter, YM Williamson, SC McGrath - Toxicon, 2015 - researchgate.nethttps://www.researchgate.net/profile/David-Schieltz/publication/270595184_Quantification_of_Ricin_RCA_and_Comparison_of_Enzymatic_Activity_in_18_Ricinus_Communis_Cultivars_by_Isotope_Dilution_Mass_Spectrometry/links/54bcedaf0cf253b50e2d85ff/Quantification-of-Ricin-RCA-and-Comparison-of-Enzymatic-Activity-in-18-Ricinus-Communis-Cultivars-by-Isotope-Dilution-Mass-Spectrometry.pdf Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry DM Schieltz, LG McWilliams, Z Kuklenyik, SM Prezioso - Toxicon, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0041010115000069

Mirodenafil dihydrochloride is a potent phosphodiesterase-5 (PDE5) inhibitor, which is a synthetic compound with a primarily chemical origin. Its mode of action involves the inhibition of the enzyme PDE5, which predominantly resides in the smooth muscle cells lining blood vessels. By inhibiting PDE5, Mirodenafil dihydrochloride effectively increases the levels of cyclic guanosine monophosphate (cGMP), leading to the relaxation of smooth muscle tissues and vasodilation. This mechanism of action makes Mirodenafil dihydrochloride particularly effective in the treatment of erectile dysfunction (ED). By enhancing blood flow to specific areas of the body, primarily the corpus cavernosum of the penis, it facilitates the achievement and maintenance of an erection in response to sexual stimulation. The compound’s selectivity for PDE5 over other phosphodiesterases minimizes potential side effects and enhances its therapeutic efficacy. As such, Mirodenafil dihydrochloride serves as a valuable tool in clinical settings for managing erectile dysfunction, providing an alternative for patients who may not respond to or tolerate other PDE5 inhibitors.

2-(2-(4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl)ethoxy)ethanol is a research tool that can be used to study the effects of Ion channels on cells. It can also be used as a pharmacological reagent for the study of receptor binding and protein interactions. 2-(2-(4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl)ethoxy)ethanol has a CAS No. 848814-27-7 and is soluble in DMSO. This product is available in high purity and it does not contain any detectable impurities.

Sheep polyclonal Prednisolone antibody

Purified recombinant PAFAH1B3 protein (His tag)

Rabbit polyclonal PRKRA antibody

CCT4 antibody was raised in Rabbit using Human CCT4 as the immunogen

AD01 is a derivative of the FK506 binding protein-like (FKBPL), and exerts potent anti-angiogenic activity in vitro and in vivo to control tumour growth.Recent studies have shown that AD-01 inhibits Rac-1 activity, and up-regulates RhoA and the actin binding proteins, profilin and vinculin.In this way, the anti-angiogenic proteins, FKBPL, and AD-01, offer a promising and alternative approach for targeting both CD44 positive tumours and vasculature networks. Recent clinical studies have shown that AD01 and other FKBPL-based peptides may offer an alternative for targeting treatment-resistant breast cancer stem cells.

H-FYCNTTQLFNSTWNV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FYCNTTQLFNSTWNV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FYCNTTQLFNSTWNV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FYCNTTQLFNSTWNV-OH at the technical inquiry form on this page

Applications Lincomycin N-Oxide is an analog of Lincomycin (L466230). Lincomycin is a lincosamide antibiotic that forms cross-links within the peptidyl transferase loop region of the 23S rRNA. Inhibits bacterial protein synthesis. Antibacterial. This compound is a contaminant of emerging concern (CECs). References Mason, D.J., et al.: Antimicrob. Agents Chemother., 555 (1962);Gray, et al.: Toxicol. Appl. Pharmacol., 6, 476 (1964);Muti, H.Y., et al.: Anal. Profiles Drug Subs. Excip., 23, 269 (1994)

A saturated fatty acid Stearic acid is used as a raw material in the production of detergents, surfactants, soaps, and cosmetics such as shampoos and shaving cream products. Its salts are used to soften polyvinyl chloride and a component of grease. It is used for the preparation of softeners in textile sizing with castor oil and dietary supplements. It acts as a hardener in candles with simple sugar or corn syrup. It is utilized for the coating of metal powders like aluminum and iron in fireworks. It finds application as a common lubricant during injection molding and pressing of ceramic powders. It acts as a key raw material for the synthesis of stearyl alcohol by reduction. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC732272 antibody, catalog no. 70R-9042

Biotin-SARS-CoV-2 Spike RBD 371-394 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 371-394 peptide. SARS-CoV-2 Spike RBD 371-394 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 371-394 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.

Selective blocker of muscular nACh receptors

Rabbit polyclonal OR10G4 antibody

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin is a high purity, ion channel ligand that is used in research as a pharmacological tool. It is an activator of Kv1.3 channels and inhibits the function of Kv1.2 channels. This product can be used for the study of protein interactions and receptor pharmacology. Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin also has been found to inhibit the binding of antibodies to cells and can be used for immunoprecipitation experiments. This product has CAS number 188476-46-4 and is available in 1 g and 5 g sizes.

Peptide H-VTSIQDWVQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VTSIQDWVQK-OH include the following: Differentially expressed haptoglobin as a potential biomarker for type 2 diabetic mellitus in Hispanic population Z Liu , D Feng , D Gu, R Zheng, C Esperat, W Gao - BioFactors, 2017 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1002/biof.1352 Serum proteomic biomarkers diagnostic of knee osteoarthritis VB Kraus , A Reed, EJ Soderblom, YM Golightly - Osteoarthritis and , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1063458423009202 Assessment of the influence of the patient's inflammatory state on the accuracy of a haptoglobin selected reaction monitoring assay O Lassout, D Hochstrasser, P Lescuyer - Clinical proteomics, 2014 - Springerhttps://link.springer.com/article/10.1186/1559-0275-11-38 Urine haptoglobin levels predict early renal functional decline in patients with type 2 diabetes NM Bhensdadia, KJ Hunt, MF Lopes-Virella - Kidney international, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0085253815558869 Quantitation of 87 proteins by nLC-MRM/MS in human plasma: workflow for large-scale analysis of biobank samples M Rezeli , K Sjödin, H Lindberg - Journal of proteome , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00235 Diagnostic protein discovery using liquid chromatography/mass spectrometry for proteolytic peptide targeting JM Koomen , H Zhao, D Li , W Nasser - Journal Devoted to , 2005 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1963 A proteogenomic analysis of haptoglobin in malaria G Awasthi , S Tyagi , V Kumar , SK Patel - PROTEOMICS , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201700077

Peptide H-RLLVPTQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RLLVPTQFV-OH include the following: Peptides derived from human insulin-like growth factor-II mRNA binding protein 3 can induce human leukocyte antigen-A2-restricted cytotoxic T lymphocytes reactive Y Tomita, M Harao, S Senju, K Imai, S Hirata - Cancer , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1349-7006.2010.01780.x

A synthetic peptide for use as a blocking control in assays to test for specificity of RFP2 antibody, catalog no. 70R-8017

DDOST antibody was raised in Rabbit using Human DDOST as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3 antibody, catalog no. 70R-3045

Rabbit polyclonal MNK1 antibody (Thr255)

Recombinant Human UBE2E3 protein with His tag

A synthetic peptide for use as a blocking control in assays to test for specificity of SR140 antibody, catalog no. 70R-4843

A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7210

ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Purified recombinant Human PTGR1 protein (His tag)

3-(Boc-amino)piperidine is used as an organic chemical synthesis intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

N-Acetylglucosamine endo-β-galactosidase 16C from Clostridium perfringens

Fmoc-Lys(Me)3-OH chloride

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176

Purified native Human Human Growth Hormone (> 60% pure)

ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH include the following: Characterizations of a neutralizing antibody broadly reactive to multiple gluten peptide: HLA-DQ2. 5 complexes in the context of celiac disease Y Okura, Y Ikawa-Teranishi, A Mizoroki - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-44083-4 Tetramer visualization of gut-homing gluten-specific T cells in the peripheral blood of celiac disease patients M Raki, LE Fallang, M Brottveit - Proceedings of the , 2007 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0608610104 The effects of ALV003 pre-digestion of gluten on immune response and symptoms in celiac disease in vivo JA Tye-Din, RP Anderson , RA Ffrench , GJ Brown - Clinical , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1521661609008651 Inhibition of HLA-DQ2-mediated antigen presentation by analogues of a high affinity 33-residue peptide from alpha2-gliadin J Xia , M Siegel , E Bergseng, LM Sollid - Journal of the American , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja056423o Equilibrium and kinetic analysis of the unusual binding behavior of a highly immunogenic gluten peptide to HLA-DQ2 J Xia , LM Sollid , C Khosla - Biochemistry, 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi047747c On the IgA antibody response to gluten in celiac disease aca˜ Steinsbo - 2015 - duo.uio.nohttps://www.duo.uio.no/handle/10852/48199

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel5 antibody, catalog no. 70R-1515

Amino-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

1-133 amino acids: MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVARSDQV RDV

Allergic Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Allergic Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Rabbit polyclonal ORC1L antibody

Canine monoclonal antibody targeting Nerve Growth Factor (NGF); pain control for osteoarthritis in dogs

4-Methylumbelliferyl-α-D-galactopyranoside

Mouse monoclonal NOP1 antibody

Upf1/Rent1 (pThr28) Antibody

WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

H-RYVPRSCGSNSYVLVPV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RYVPRSCGSNSYVLVPV-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RYVPRSCGSNSYVLVPV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RYVPRSCGSNSYVLVPV-OH at the technical inquiry form on this page

Bromothymol Blue is a pH indicator used for measuring pH around 7 in pools and fish tanks. It operates in the pH range 6.0 to 7.6 due to the presence of an electron withdrawing and donating groups like bromine atoms and alkyl substitutents respectively. In the laboratory, it is used as a biological slide stain as well as used in obstetrics for detecting premature rupture of membranes. Further, it is used for the observation of photosynthetic activities and a respiratory indicator. In addition to this, it is used to define cell walls or nuclei under the microscope. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

Clickable Arg9 peptide.

N6AMT2 antibody was raised in Rabbit using Human N6AMT2 as the immunogen

Peptide H-DAVQATKPDMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DAVQATKPDMR^-OH include the following: Rapid detection of colistin resistance protein MCR-1 by LC-MS/MS H Wang, Y Chen, JR Strich , SK Drake, JH Youn - Clinical proteomics, 2019 - Springerhttps://link.springer.com/article/10.1186/s12014-019-9228-2

Tos-PEG5-CH2CO2t-butyl ester