Biochemicals and Reagents

The Myeloperoxidase antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to myeloperoxidase, an enzyme found in abundance in neutrophils and monocytes. By binding to myeloperoxidase, this antibody can be used for a variety of applications including immunohistochemistry, flow cytometry, and Western blotting. One of the key characteristics of this antibody is its high specificity and affinity for myeloperoxidase. It recognizes and binds to the tyrosine residues on the enzyme, allowing for accurate detection and quantification. This makes it an ideal choice for researchers studying inflammatory processes, as myeloperoxidase is often involved in these pathways. In addition to its use as a research tool, this Myeloperoxidase antibody also has potential therapeutic applications. It has been shown to have anti-connexin properties, making it useful in the treatment of certain autoimmune

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK13 antibody, catalog no. 70R-5226

Rabbit polyclonal CCL7 antibody

Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GFYAEGSR^-OH include the following: Mass spectrometry-based proteomics in basic and translational research of SARS-CoV-2 coronavirus and its emerging mutants Y Rais, Z Fu , AP Drabovich - Clinical Proteomics, 2021 - Springerhttps://link.springer.com/article/10.1186/s12014-021-09325-x Advances in rapid detection of SARS-CoV-2 by mass spectrometry TF Wong, PK So, ZP Yao - TrAC Trends in Analytical Chemistry, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165993622002424 Specific and rapid SARS-CoV-2 identification based on LC-MS/MS analysis O Schuster, A Zvi, O Rosen, H Achdout - ACS , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.0c04691 Variable posttranslational modifications of severe acute respiratory syndrome coronavirus 2 nucleocapsid protein NT Supekar , A Shajahan , AS Gleinich - , 2021 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/31/9/1080/6275362 Development of a parallel reaction monitoring mass spectrometry assay for the detection of SARS-CoV-2 spike glycoprotein and nucleoprotein LH Cazares , R Chaerkady , SH Samuel Weng - Analytical , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.0c02288 Discriminative Identification of SARS-CoV-2 Variants Based on Mass-Spectrometry Analysis L Feldberg, A Zvi, Y Yahalom-Ronen, O Schuster - Biomedicines, 2023 - mdpi.comhttps://www.mdpi.com/2227-9059/11/9/2373 Peptide and protein de novo sequencing by mass spectrometry KG Standing - Current opinion in structural biology, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0959440X03001386 Targeted proteomics for the detection of SARS-CoV-2 proteins K Bezstarosti, MM Lamers , BL Haagmans - Biorxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.04.23.057810.abstract Mass spectrometry approaches for SARS-CoV-2 detection: harnessing for application in food and environmental samples E Bojorquez-Velazquez , ML Llamas-Garcaca­a - Viruses, 2022 - mdpi.comhttps://www.mdpi.com/1999-4915/14/5/872 Shortlisting SARS-CoV-2 peptides for targeted studies from experimental data-dependent acquisition tandem mass spectrometry data D Gouveia , L Grenga , JC Gaillard, F Gallais - , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.202000107 Proteotyping SARS-CoV-2 virus from nasopharyngeal swabs: a proof-of-concept focused on a 3 min mass spectrometry window D Gouveia , G Miotello, F Gallais - Journal of Proteome , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.0c00535 Quantification of SARS-CoV-2 spike and nucleocapsid proteins using isotope dilution tandem mass spectrometry C Pierce-Ruiz, WI Santana, WJH Sutton, DA Fischler - Vaccine, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X21009592 Simultaneous monitoring of eight human respiratory viruses including SARS-CoV-2 using liquid chromatography-tandem mass spectrometry C Hodgkins, LK Buckton, GJ Walker , B Crossett - Scientific Reports, 2022 - nature.comhttps://www.nature.com/articles/s41598-022-16250-y

The RAGE Blocking Peptide is a highly effective cytotoxic peptide that targets the nuclear receptor RAGE (Receptor for Advanced Glycation Endproducts). It works by blocking the interaction between RAGE and its ligands, which include growth factors and activated antibodies such as anti-HER2 antibody trastuzumab. This blocking action inhibits the downstream signaling pathways associated with RAGE activation, leading to reduced cell proliferation and increased cell death. In addition to its cytotoxic effects, the RAGE Blocking Peptide has been shown to modulate various cellular processes. It can decrease viscosity in biological fluids, making it useful in applications where fluidity is important. The peptide has also been found to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Researchers and scientists in the field of life sciences have utilized the RAGE Blocking Peptide as a valuable tool in their studies. Its ability to specifically target RAGE makes it an ideal reagent for investigating the

A synthetic peptide for use as a blocking control in assays to test for specificity of CTTN antibody, catalog no. 70R-2725

2-Cyclopentylidene-2-phenylacetic acid is a potent inhibitor of kinases and proteins in humans. It is an analog of medicinal compounds used to treat tumors and induce apoptosis in cancer cells. This compound has been shown to be an effective inhibitor of Chinese hamster ovary (CHO) cell kinases, making it a promising anticancer agent. 2-Cyclopentylidene-2-phenylacetic acid has also been found in human urine, indicating that it may have potential as a diagnostic marker for cancer. Its ability to inhibit the growth of cancer cells makes it a promising candidate for further research into developing new anticancer drugs.

Affinity purified Rabbit polyclonal CYFIP2 antibody

Peptide H-AAFDDAIAELDTLSEESYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AAFDDAIAELDTLSEESYK-OH include the following: Flexible Quality Control for Protein Turnover Rates Using d2ome HM Deberneh, RG Sadygov - International journal of molecular sciences, 2023 - mdpi.comhttps://www.mdpi.com/1422-0067/24/21/15553 Quantitative proteomic analysis reveals high interference on protein expression of H9c2 cells activated with glucose and cardiotonic steroids E Meneses-Romero, L Hernandez-Orihuela - Journal of , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391919303082

Poly(caprolactone-co-glycolide) 45:55

mGluR5 antagonist

LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL

A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL9 antibody, catalog no. 70R-2833

Affinity purified Rabbit polyclonal CDC37L1 antibody

Rabbit polyclonal mTOR antibody

Please enquire for more information about Dienogest-d8 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-VTAQELDYLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VTAQELDYLTR^-OH include the following: Application of LC-MS/MS MRM to determine staphylococcal enterotoxins (SEB and SEA) in milk M Andjelkovic, V Tsilia , A Rajkovic , K De Cremer - Toxins, 2016 - mdpi.comhttps://www.mdpi.com/2072-6651/8/4/118 Detection, confirmation, and quantification of staphylococcal enterotoxin B in food matrixes using liquid chromatography-mass spectrometry JH Callahan, KJ Shefcheck, TL Williams - Analytical , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac051292v Quantitative analysis of Staphylococcal enterotoxins A and B in food matrices using ultra high-performance liquid chromatography tandem mass spectrometry (UPLC A Zuberovic Muratovic, T Hagström, J Rosen - Toxins, 2015 - mdpi.comhttps://www.mdpi.com/2072-6651/7/9/3637

Bosentan is a dual endothelin receptor antagonist that is used to treat hypertension. This drug works by blocking the action of endothelin molecules which prevents the narrowing of blood vessels and decreases blood pressure. Bosentan is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit polyclonal RPL17 antibody (HRP)

Purified Goat IgG (Fab'2) FITC conjugate

H-GPGGTFQGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GPGGTFQGR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GPGGTFQGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GPGGTFQGR-OH at the technical inquiry form on this page

Purified Recombinant GHR protein

Peptide H-RQPKIWFPNRRKPWKKRPRPDDLEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RQPKIWFPNRRKPWKKRPRPDDLEI-OH include the following: Peptide and protein application in tissue repair and regeneration P Pereira - Peptide and Protein Delivery, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780123849359100124 The connexin 43 carboxyl terminal mimetic peptide alphaCT1 prompts differentiation of a collagen scar matrix in humans resembling unwounded skin J Montgomery, WJ Richardson , S Marsh - : official publication of , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8667734/ Inhibitory Effects of Alpha-Connexin Carboxyl-Terminal Peptide on Canine Mammary Epithelial Cells: A Study on Benign and Malignant Phenotypes IIM da Fonseca, MK Nagamine , A Sato, CA Rossatto-Jr - Cancers, 2024 - mdpi.comhttps://www.mdpi.com/2072-6694/16/4/820 Connexin43 carboxyl-terminal peptides reduce scar progenitor and promote regenerative healing following skin wounding GS Ghatnekar, MP O'Quinn , LJ Jourdan - 2009 - Future Medicinehttps://www.futuremedicine.com/doi/abs/10.2217/17460751.4.2.205 Targeting connexin 43 with alpha-connexin carboxyl-terminal (ACT1) peptide enhances the activity of the targeted inhibitors, tamoxifen and lapatinib, in breast cancer CL Grek, JM Rhett , JS Bruce, MA Abt, GS Ghatnekar - BMC cancer, 2015 - Springerhttps://link.springer.com/article/10.1186/s12885-015-1229-6 PILING-Peptide-based Ionic liquids towards heaLING of complicated skin infections ASM Gomes - 2021 - repositorio-aberto.up.pthttps://repositorio-aberto.up.pt/bitstream/10216/138826/2/522620.pdf Effects of alpha-connexin carboxyl-terminal peptide (aCT1) and bowman-birk protease inhibitor (BBI) on canine oral mucosal melanoma (OMM) cells A Sato, IIM Da Fonseca, MK Nagamine - Frontiers in Veterinary , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fvets.2021.670451/full Wound-healing peptides for treatment of chronic diabetic foot ulcers and other infected skin injuries A Gomes, C Teixeira , R Ferraz , C Prudacaªncio , P Gomes - Molecules, 2017 - mdpi.comhttps://www.mdpi.com/1420-3049/22/10/1743 Bioactive peptides: Synthesis, applications, and associated challenges A Alzaydi, RI Barbhuiya , W Routray - Food , 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/fbe2.12057

Please enquire for more information about 14-3-3 Ζ, Gst tagged human including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Rabbit polyclonal INTS2 antibody

Please enquire for more information about GNE-3511 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

GIMAP7 antibody was raised in Rabbit using Human GIMAP7 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of NNT antibody, catalog no. 70R-6519

Recombinant SARS Associated Coronavirus Nucleocaspid (1-49,192-220)

Rabbit polyclonal FYN antibody

Rabbit polyclonal CTDNEP1 antibody (HRP)

Spectinomycin dihydrochloride pentahydrate

Rabbit polyclonal BMX antibody

Please enquire for more information about Gliadin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of LSM2 antibody, catalog no. 70R-1438

NVP-AEW541 is a chemical inhibitor that has been shown to inhibit cellular transformation in vitro. It inhibits the receptor activity of IGF-I, which is a protein that stimulates cell growth and proliferation. NVP-AEW541 has also been shown to inhibit cancer cells in vitro by inhibiting the polymerase chain reaction and mitochondrial membrane potential. NVP-AEW541 has not been tested for efficacy in animal models or human subjects, however it has shown promising results in colorectal adenocarcinoma cell lines and subcutaneous tumors.

Purified recombinant PDGFRa protein

Peptide H-FRDYVDRFFKTLRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FRDYVDRFFKTLRAE-OH include the following: CTL epitope distribution patterns in the Gag and Nef proteins of HIV-1 from subtype A infected subjects in Kenya: use of multiple peptide sets increases the detectable JR Currier, U Visawapoka, S Tovanabutra, CJ Mason - BMC immunology, 2006 - Springerhttps://link.springer.com/article/10.1186/1471-2172-7-8

Spermine

Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.

Ac-His-D-Phe(p-Iodo)-Arg-Trp-NH2 is a peptide that binds to the melanocortin receptor. It is a potent antagonist of MSH and related peptides and has been shown to be effective in the treatment of cancer, including melanoma.

H-AFGIPVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AFGIPVR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AFGIPVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AFGIPVR-OH at the technical inquiry form on this page

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

CD44 antibody was raised in Mouse using a purified recombinant fragment of human CD44 (628-699) expressed in E. coli as the immunogen.

TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogen

Purified recombinant Hepatitis C Virus NS4 protein

Mouse monoclonal BUB1B antibody

The exosome positive control is a component of our Exosome Kits , products ME-020 and ME-020P and consists of exosomes purified from HEK293 cells.  This can also be purchased as a standalone research tool for studying exosomes and their role in regulating cellular function.

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

Hemoglobin A Rabbit Monoclonal Antibody

Cortisol 3-CMO is a highly effective antibody-drug conjugate that targets choroidal neovascularization, a condition characterized by the abnormal growth of blood vessels in the choroid layer of the eye. It works by binding to specific growth factors involved in this process and delivering a cytotoxic toxin subunit to the targeted cells. This leads to the lysis and elimination of these cells, effectively treating the condition. The unique feature of Cortisol 3-CMO is its fluorophore component, which allows for easy visualization and tracking of the drug within the body. This enables healthcare professionals to monitor its distribution and efficacy during treatment. In addition to its therapeutic benefits, Cortisol 3-CMO also exhibits excellent photostability, ensuring its potency even under prolonged exposure to light. This makes it a reliable and long-lasting solution for patients suffering from choroidal neovascularization. Developed using advanced monoclonal antibody technology, Cortisol 3-CMO offers high specificity and

Inhibitor of ribosomal protein kinase p70S6K

maMyc

Peptide H-SLEGSDDAVLLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLEGSDDAVLLQR-OH include the following: Characterization of the dystrophin-associated protein complex by mass spectrometry EH Canessa , R Spathis, JS Novak - Mass spectrometry , 2024 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/mas.21823 Absolute quantification of dystrophin protein in human muscle biopsies using parallel reaction monitoring (PRM) EH Canessa , MV Goswami , TD Alayi - Journal of mass , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4437

Mouse sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

Purified Polyclonal PAX9 antibody

Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC3207 antibody, catalog no. 70R-10083

H-TWLFSNCRTLLSRVY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TWLFSNCRTLLSRVY-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TWLFSNCRTLLSRVY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TWLFSNCRTLLSRVY-OH at the technical inquiry form on this page

EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TAPBP antibody, catalog no. 70R-6847

Rabbit polyclonal NFKB p105 antibody

Benzyl-PEG6-CH2CO2tBu

A recombinant CD22-targeting monoclonal antibody

Rabbit polyclonal SMG7 antibody

Rabbit polyclonal RPL19 antibody

MeO-Suc-Arg-Pro-Tyr-MCA is a peptide substrate for chymotrypsin. It is used as an inhibitor of the enzyme and has been shown to inhibit the activity of chymotrypsin with an IC50 of 0.2 mM.

CKBB antibody was raised in mouse using human Brain CKBB as the immunogen.

Sanguinarine chloride hydrate is a benzophenanthridine alkaloid, which is a plant-derived compound primarily extracted from species of the Papaveraceae family, such as the bloodroot plant. This compound functions through multiple biological mechanisms, including the inhibition of various enzymes and interference with protein synthesis. Specifically, sanguinarine chloride has been shown to intercalate with DNA, inducing apoptosis in different cell types. Due to its potent bioactivity, sanguinarine chloride is extensively studied for its potential applications in medical and biological research. It exhibits antibacterial, anti-inflammatory, and anticancer properties, making it a subject of interest for developing therapeutics targeting bacterial infections, inflammatory diseases, and cancer. Additionally, its ability to modulate signal transduction pathways offers insights into its role in cell proliferation and apoptosis, facilitating its use in cell biology and pharmacological studies.

H-AIEAQQHMLKLTVWG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AIEAQQHMLKLTVWG-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AIEAQQHMLKLTVWG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AIEAQQHMLKLTVWG-OH at the technical inquiry form on this page

CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.

KU-60019 is a potent and selective inhibitor of the epidermal growth factor receptor (EGFR) tyrosine kinase. KU-60019 blocks the activation of EGFR and other signaling pathways, which may be involved in the pathogenesis of autoimmune diseases, cancer and metabolic disorders. KU-60019 inhibits cellular proliferation by inhibiting tyrosine phosphorylation in the EGFR pathway. In addition, KU-60019 also inhibits DNA synthesis and cell cycle progression by targeting other intracellular targets such as cyclin D1, CDK4, CDK6 and p27. The chemical structure of KU-60019 is similar to that of imatinib mesylate, an inhibitor for chronic myeloid leukemia that has been approved by the FDA for treatment. However, unlike imatinib mesylate, KU-60019 does not inhibit protein kinase C or Raf kinases. Further investigations are needed to determine the mechanism

[β-Ala]-[Lys(5-TAMRA)]-acid

25-505 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMSDV LELTDDNFES RISDTGSAGL MLVEFFAPWC GHCKRLAPEY EAAATRLKGI VPLAKVDCTA NTNTCNKYGV SGYPTLKIFR DGEEAGAYDG PRTADGIVSH LKKQAGPASV PLRTEEEFKK FISDKDASIV GFFDDSFSEA HSEFLKAASN LRDNYRFAHT NVESLVNEYD DNGEGIILFR PSHLTNKFED KTVAYTEQKM TSGKIKKFIQ ENIFGICPHM TEDNKDLIQG KDLLIAYYDV DYEKNAKGSN YWRNRVMMVA KKFLDAGHKL NFAVASRKTF SHELSDFGLE STAGEIPVVA IRTAKGEKFV MQEEFSRDGK ALERFLQDYF DGNLKRYLKS EPIPESNDGP VKVVVAENFD EIVNNENKDV LIEFYAPWCG HCKNLEPKYK ELGEKLSKDP NIVIAKMDAT ANDVPSPYEV RGFPTIYFSP ANKKLNPKKY EGGRELSDFI SYLQREATNP PVIQEEKPKK KKKAQEDL

LBR antibody was raised in Rabbit using Human LBR as the immunogen

Rabbit polyclonal OR52B2 antibody

Peptide H-EFRHDSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EFRHDSC-OH include the following: Detection of peri-synaptic amyloid-beta pyroglutamate aggregates in early stages of Alzheimer's disease and in AbetaPP transgenic mice using a novel monoclonal M Mandler, E Rockenstein, K Ubhi - Journal of , 2012 - content.iospress.comhttps://content.iospress.com/articles/journal-of-alzheimers-disease/jad111208

Nociceptin is a potent anti-analgesic, effectively counteracting the effect of pain-relievers. A neuropeptide that modulates nociception, it acts by binding the nociceptin receptor (NOP). Nociceptin does not bind to μ, θ', or K opioid receptors and thus lacks the addictive potential. Administration of nociceptin leads to sensations of pain and is associated with memory, learning, eating, and anxiety.

A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS3 antibody, catalog no. 70R-2515

ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF

Fmoc-OSu is a synthetic amino acid that is used in the synthesis of peptides and other biomolecules. It can be synthesized by solid-phase peptide synthesis using Fmoc chemistry, which involves an acid-labile protecting group. Fmoc-OSu has been shown to inhibit cancer cell growth, although its mechanism is not known. Fmoc-OSu has been shown to have anti-inflammatory effects by inhibiting the proinflammatory cytokine TNFα. Fmoc-OSu has also been shown to have glycan binding properties, which may be due to its ability to bind with sialic acid residues on glycoproteins or glycolipids.

Bovine RBC antibody was raised in rabbit using bovine erythrocytes as the immunogen.

DDOST (71-77) (heavy) is derived from dolichyl-diphosphooligosaccharide-protein glycosyltransferase (DDOST). Congenital disorders of glycosylation are associated with functionally inactive DDOST. The arginine residue at position 11 is isotopically labelled with carbon-13 (6) and nitrogen-15 (4).

Purified Pig IgG (Fab'2) HRP conjugate

Affinity purified Rabbit polyclonal Cyclin I2 antibody

Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Cyc-Biot-CGKGRGLC-NH2 include the following: Structural specificity of substrate for S-adenosylmethionine protein arginine N-methyltransferases N Rawal, R Rajpurohit, MA Lischwe - et Biophysica Acta (BBA , 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016748389400213Z

Rabbit polyclonal ZFP36 antibody

Purified Polyclonal SMAD3 antibody

CD154 antibody was raised in mouse using human sgp39 fusion protein as the immunogen.

CTR9 antibody was raised in Rabbit using Human CTR9 as the immunogen

Citalopram is a selective serotonin reuptake inhibitor that is used for the treatment of depression. It has also been found to relieve and manage symptoms of anxiety, eating disorders and OCD. Citalopram targets serotonin by inhibiting its reuptake in the synaptic cleft. In vitro studies demonstrate that citalopram is a strong and selective inhibitor of neuronal serotonin reuptake and has weak effects on norepinephrine and dopamine central reuptake. . Citalopram HBr is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

ESX1 antibody was raised in Rabbit using Human ESX1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FDFT1 antibody, catalog no. 70R-1132

The MIT protein, also known as alpha-galactose antigen, is a highly versatile and potent antibody-drug that has various applications in the field of Life Sciences. This monoclonal antibody specifically targets and binds to the alpha-gal epitope, which is present on a wide range of native proteins and antigens. It can be immobilized for use in assays or purification processes, making it an essential tool for researchers. In addition to its binding capabilities, the MIT protein also exhibits phosphatase activity. This enzymatic function allows for the dephosphorylation of specific substrates, enabling further research into cellular signaling pathways and protein regulation. Furthermore, the MIT protein has been shown to interact with histone H3 and interleukin molecules, suggesting potential roles in gene expression regulation and immune response modulation. Its alkaline properties make it suitable for use in various experimental techniques. Overall, the MIT protein offers a valuable resource for scientists in their quest to unravel complex biological processes and develop innovative

A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-8788

Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.

A synthetic spider toxin, sourced from the Funnel Web Spider, Agelenopsis aperta. This toxin can be applied as a P-type Ca2+ channel selective blocker and has disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34. This product is available as a 0.1mg vial.

Peptide H-ELLHAPATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELLHAPATV-OH include the following: Identification of highly conserved surface-exposed peptides of spike protein for multiepitope vaccine design against emerging omicron variants: An immunoinformatic MS Khan , M Shakya , CK Verma, R Mukherjee - Human Immunology, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S019888592400380X

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC8E antibody, catalog no. 70R-6993

MAPK9 antibody was raised in Rabbit using Human MAPK9 as the immunogen

Peptide Ac-DRVYIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-DRVYIHPFHL-OH include the following: Investigation of angiotensin glycosylation by MALDI-TOF and ESI tandem mass spectrometry SJ Park, DH Park , S Sul, SF Oh, IS Park - Bull. Korean Chem , 2004 - researchgate.nethttps://www.researchgate.net/profile/Deok-Hie-Park/publication/264033425_Investigation_of_angiotensin_glycosylation_by_MALDI-TOF_and_ESI_tandem_mass_spectrometry/links/591c0551aca272bf75c86b6d/Investigation-of-angiotensin-glycosylation-by-MALDI-TOF-and-ESI-tandem-mass-spectrometry.pdf Design of substrate-type ACE inhibitory pentapeptides with an antepenultimate C-terminal proline for efficient release of inhibitory activity S Rao, S Liu, T Ju, W Xu, G Mei, Y Xu - Biochemical engineering , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1369703X11002634 Structure-based design of altered MHC class II-restricted peptide ligands with heterogeneous immunogenicity S Chen, Y Li, FR Depontieu, TL McMiller - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/191/10/5097/86685 Cleavage of arginyl-arginine and lysyl-arginine from the C-terminus ofpro-hormone peptides by human germinal angiotensin I-converting enzyme (ACE) and the C RE ISAAC, AT WILLIAMS , M SAJID - Biochemical , 1997 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/328/2/587/34291 Molecular features influencing the release of peptides from amphiphilic polymeric reverse micelles MAC Serrano, B Zhao , H He , S Thayumanavan - Langmuir, 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.langmuir.7b04065 Sonolytic hydrolysis of peptides in aqueous solution upon addition of catechol M Sakakura, M Takayama - Ultrasonics sonochemistry, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1350417708001570 Purification and identification of ACE inhibitory peptides from Haruan (Channa striatus) myofibrillar protein hydrolysate using HPLC-ESI-TOF MS/MS M Ghassem , K Arihara, AS Babji, M Said, S Ibrahim - Food chemistry, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0308814611009381 Lactoferricin-related peptides with inhibitory effects on ACE-dependent vasoconstriction JM Centeno, MC Burguete - Journal of agricultural , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf060482j Structure-Based Design of Altered MHC II Class - 2013 - researchgate.nethttps://www.researchgate.net/profile/Donald-Hunt/publication/257599651_Structure-Based_Design_of_Altered_MHC_Class_II-Restricted_Peptide_Ligands_with_Heterogeneous_Immunogenicity/links/0046352f7d90688dac000000/Structure-Based-Design-of-Altered-MHC-Class-II-Restricted-Peptide-Ligands-with-Heterogeneous-Immunogenicity.pdf Detection of chymase activity using a specific peptide probe conjugated onto gold nanoparticles HF Chang, YL Sun, FY Yeh, IH Tseng, CC Chang - RSC , 2018 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2018/ra/c8ra04322a Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect DR Brims, J Qian, I Jarchum, L Mikesh - International , 2010 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/22/3/191/792084 Identification of a potent Angiotensin-I converting enzyme inhibitory peptide from Black cumin seed hydrolysate using orthogonal bioassay-guided fractionations CCY Sutopo , A Sutrisno , LF Wang, JL Hsu - Process biochemistry, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1359511319314199

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

PAX3 antibody was raised in mouse using recombinant Human Paired Box Gene 3 (Waardenburg Syndrome 1) (Pax3)

CAPG antibody was raised in Rabbit using Human CAPG as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of AASDHPPT antibody, catalog no. 70R-2638

MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR

Mouse monoclonal Fibrinogen antibody

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Applications N-2-Pyridinyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzamide is a reagent used in the synthesis of a compound applied as a Bruton tyrosine kinase inhibitor and its use for treating or relieving BTK-mediated disease. References Li, Y. et al.: PCT Int. Appl. 108 pp., (2018)

Peptide Ac-CRKQPVKEVPQFSEED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CRKQPVKEVPQFSEED-NH2 include the following: Derepression of Y-linked multicopy protamine-like genes interferes with sperm nuclear compaction in D. melanogaster JI Park, GW Bell , YM Yamashita - Proceedings of the , 2023 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2220576120 Deregulation of Y-linked protamine-like genes in sex chromosome-biased spermatid demise JI Park, GW Bell , YM Yamashita - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.12.04.519051.abstract

H-SQVTNSATIMMQRGNFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SQVTNSATIMMQRGNFR-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SQVTNSATIMMQRGNFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SQVTNSATIMMQRGNFR-OH at the technical inquiry form on this page

Purified recombinant ULBP1 protein (His tag)

Amino acids 39-68 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC41A1 antibody, catalog no. 70R-6600

H-CTPAGYAILKCNNKT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CTPAGYAILKCNNKT-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CTPAGYAILKCNNKT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CTPAGYAILKCNNKT-OH at the technical inquiry form on this page

Rabbit Polyclonal PDK1 antibody

Mouse monoclonal C9orf41 antibody

H-WMVLPWLPGTLDGGSGCRG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WMVLPWLPGTLDGGSGCRG-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WMVLPWLPGTLDGGSGCRG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WMVLPWLPGTLDGGSGCRG-OH at the technical inquiry form on this page

Mouse monoclonal ERMAP antibody

Purified recombinant Human DIMT1 protein (His tag)

Amino acids 865-879 of microtubule-associated protein 1A (MAP1A) light chain. MAP1A is a structural protein essential for the organisation of neuronal microtubules (MTs) and is abundantly expressed in the mammalian brain. MAP1A is thought to help maintain the neuronal MT network, and modulate synaptic proteins and neuronal survival in the adult central nervous system (CNS).MAP1A is expressed from the Map1a gene which encodes a precursor polypeptide which is cleaved to produce MAP1A heavy chain and light chain.When MAP1A is disrupted in the body it results in problems in coordination, tremors, and late-onset degeneration of cerebellar Purkinje cells.

Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.

H-WLISQNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WLISQNK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WLISQNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WLISQNK-OH at the technical inquiry form on this page

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

Peptide H-LSEPAELTDAVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSEPAELTDAVK-OH include the following: Quantitative analysis of prostate specific antigen isoforms using immunoprecipitation and stable isotope labeling mass spectrometry YT Chen , LP Tuan, HW Chen , IA Wei - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac5033066 HILIC-MRM-MS for linkage-specific separation of sialylated glycopeptides to quantify prostate-specific antigen proteoforms YEM van der Burgt , KM Siliakus - Journal of proteome , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.0c00050 A review on mass spectrometry-based quantitative proteomics: Targeted and data independent acquisition V Vidova, Z Spacil - Analytica chimica acta, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267017301502 "œProduct ion monitoring" assay for prostate-specific antigen in serum using a linear ion-trap V Kulasingam , CR Smith, I Batruch - Journal of proteome , 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr7005999 Antibody-free, targeted mass-spectrometric approach for quantification of proteins at low picogram per milliliter levels in human plasma/serum T Shi , TL Fillmore, X Sun, R Zhao - Proceedings of the , 2012 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1204366109 Multiplexed targeted mass spectrometry assays for prostate cancer-associated urinary proteins T Shi , SI Quek , Y Gao , CD Nicora , S Nie , TL Fillmore - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731921/ Analysis of serum total and free PSA using immunoaffinity depletion coupled to SRM: correlation with clinical immunoassay tests T Liu , M Hossain, AA Schepmoes, TL Fillmore - Journal of , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391912000759 Clinical quantitation of prostate-specific antigen biomarker in the low nanogram/milliliter range by conventional bore liquid chromatography-tandem mass T Fortin, A Salvador, JP Charrier , C Lenz - Molecular & Cellular , 2009 - ASBMBhttps://www.mcponline.org/article/S1535-9476(20)34547-3/fulltext Multiple reaction monitoring cubed for protein quantification at the low nanogram/milliliter level in nondepleted human serum T Fortin, A Salvador, JP Charrier , C Lenz - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac901447h Direct cancer tissue proteomics: a method to identify candidate cancer biomarkers from formalin-fixed paraffin-embedded archival tissues SI Hwang , J Thumar, DH Lundgren, K Rezaul, V Mayya - Oncogene, 2007 - nature.comhttps://www.nature.com/articles/1209755 Deep-dive targeted quantification for ultrasensitive analysis of proteins in nondepleted human blood plasma/serum and tissues S Nie , T Shi , TL Fillmore, AA Schepmoes - Analytical , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.7b01878 Hydrophilic interaction liquid chromatography as second dimension in multidimensional chromatography with an anionic trapping strategy: application to prostate R Simon, S Passeron, J Lemoine , A Salvador - Journal of Chromatography , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967314008486 Investigation on core-fucosylated prostate-specific antigen as a refined biomarker for differentiation of benign prostate hyperplasia and prostate cancer of different R Lang , V Rolny, A Leinenbach, J Karl - Tumor , 2019 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/1010428319827223 An endoglycosidase-assisted LC-MS/MS-based strategy for the analysis of site-specific core-fucosylation of low-concentrated glycoproteins in human serum using R Lang , A Leinenbach, J Karl, M Swiatek-de Lange - Clinica Chimica , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898118300482 Systematic quantification of peptides/proteins in urine using selected reaction monitoring N Selevsek, M Matondo , MS Carbayo - , 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000599 Assay Configuration and Analytic Specificity May Have Major Effects on Prediction of Clinical Outcomes-Implications for Reference Standards GG Klee - Clinical chemistry, 2009 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/55/5/848/5629270 Studies of Protein Function by Liquid Chromatography-Mass Spectrometry GD Williams - 2014 - library-archives.canada.cahttps://library-archives.canada.ca/eng/services/services-libraries/theses/Pages/item.aspx?idNumber=1033064886 of prostate-specific antigen measured using immune extraction, trypsin digestion, and tandem mass spectrometry quantification of LSEPAELTDAVK peptide EW Klee , OP Bondar - of Pathology and , 2014 - meridian.allenpress.comhttps://meridian.allenpress.com/aplm/article-abstract/138/10/1381/65221 In Vitro Selection of DNA Aptamers Against Prostate Cancer Peptide Biomarkers E Kuguoglu - 2014 - stars.library.ucf.eduhttps://stars.library.ucf.edu/cgi/viewcontent.cgi?article=2803&context=honorstheses1990-2015 Delineating monoclonal antibody specificity by mass spectrometry D Korbakis , I Prassas , D Brinc, I Batruch, B Krastins - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S187439191400517X Chromosome 19 annotations with disease speciation: a first report from the Global Research Consortium CL Nilsson , F Berven, F Selheim , H Liu - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3008607 Verification of a biomarker discovery approach for detection of Down syndrome in amniotic fluid via multiplex selected reaction monitoring (SRM) assay CKJ Cho , AP Drabovich , I Batruch, EP Diamandis - Journal of proteomics, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391911002168 Current affairs in quantitative targeted proteomics: multiple reaction monitoring-mass spectrometry AK Yocum , AM Chinnaiyan - Briefings in Functional Genomics , 2009 - academic.oup.comhttps://academic.oup.com/bfg/article-abstract/8/2/145/201063 Peptide Dimethylation: Fragmentation Control via Distancing the Dimethylamino Group AJ McShane, Y Shen, MJ Castillo - Journal of The American , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-014-0951-7 Bioinformatic strategies for unambiguous identification of prostate specific antigen in clinical samples aca Vegvari , M Rezeli , J Hakkinen , C Sihlbom - Journal of , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S187439191100265X Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring aca Vegvari , K Sjödin, M Rezeli , J Malm, H Lilja - Molecular & Cellular , 2013 - ASBMBhttps://www.mcponline.org/article/S1535-9476(20)30666-6/fulltext Identification of Missing Proteins: Toward the Completion of Human Proteome aca Vegvari - Genomics and Proteomics for Clinical Discovery and , 2014 - Springerhttps://link.springer.com/chapter/10.1007/978-94-017-9202-8_2 Development of a Chip/Chip/SRM platform using digital chip isoelectric focusing and LC-Chip mass spectrometry for enrichment and quantitation of low abundance A Rafalko, S Dai , WS Hancock , BL Karger - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr2006704

Peptide H-QEPVSPKKKENALLRYLLDKDDTKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QEPVSPKKKENALLRYLLDKDDTKD-OH include the following: Structural basis for the hepatoprotective effects of antihypertensive 1, 4-dihydropyridine drugs Y Wei, Y Lu, Y Zhu, W Zheng , F Guo, B Yao - et Biophysica Acta (BBA , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304416518302137 Identification of an oleanane-type triterpene hedragonic acid as a novel farnesoid X receptor ligand with liver protective effects and anti-inflammatory activity Y Lu, W Zheng , S Lin , F Guo, Y Zhu, Y Wei, X Liu - Molecular , 2018 - ASPEThttps://molpharm.aspetjournals.org/content/93/2/63.abstract Doubling the size of the glucocorticoid receptor ligand binding pocket by deacylcortivazol K Suino-Powell, Y Xu , C Zhang, Y Tao - and cellular biology, 2008 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/MCB.01541-07

Peptide H-LTGISDPVTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LTGISDPVTVK^-OH include the following: Noelin1 affects lateral mobility of synaptic AMPA receptors NJ Pandya , C Seeger, N Babai , MA Gonzalez-Lozano - Cell reports, 2018 - cell.comhttps://www.cell.com/cell-reports/pdf/S2211-1247(18)31044-1.pdf