Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules
- By Biological Target
- By Pharmacological Effects
- Cryopreservatives
- Desinfectants and Related Compounds
- Hormones
- Plant Biology
- Secondary Metabolites
Products of "Biochemicals and Reagents"
Sort by
GLMN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLMN antibody, catalog no. 70R-5818Purity:Min. 95%IL1 α antibody
IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1-alpha as the immunogen.MTA3 antibody
MTA3 antibody was raised in mouse using recombinant Human Metastasis Associated 1 Family, Member 3Carnosol
CAS:CarnosolFormula:C20H26O4Purity:98.67% (Typical Value in Batch COA)Color and Shape: solidMolecular weight:330.42g/molLeptin antibody
Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.Purity:Min. 95%H-DSSEEK-OH
H-DSSEEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DSSEEK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DSSEEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DSSEEK-OH at the technical inquiry form on this pagePurity:Min. 95%1,3-Pyrrolidinedicarboxylic acid, 3-methyl 1-(phenylmethyl) ester
CAS:Formula:C14H17NO4Purity:98%Color and Shape:LiquidMolecular weight:263.2891Bordetella Pertussis Toxin IgA /IgG Negative Human Serum
Bordetella Pertussis Toxin IgA /IgG Negative Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Bordetella Pertussis Toxin IgA /IgG Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.α β TcR antibody
The alpha beta TcR antibody is a monoclonal antibody that specifically targets the alpha beta T-cell receptor (TcR). This antibody is widely used in Life Sciences research to study T-cell biology and function. It can be used to detect and quantify T-cells expressing the alpha beta TcR, as well as to investigate the interaction between T-cells and their target molecules. In addition, this antibody has shown potential therapeutic applications. It has been used in studies investigating autoimmune diseases such as insulin-dependent diabetes mellitus, where autoantibodies against insulin are present. The alpha beta TcR antibody can help researchers understand the role of T-cells in these diseases and potentially develop new treatments. Furthermore, this antibody has been utilized in research on growth factors and their signaling pathways. It has been shown to interact with specific growth factors, such as ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco), which plays a crucial roleC1D antibody
C1D antibody was raised in rabbit using the middle region of C1D as the immunogenPurity:Min. 95%G6PD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of G6PD antibody, catalog no. 70R-3240Purity:Min. 95%MSH6 antibody
MSH6 antibody was raised in Mouse using a purified recombinant fragment of MSH6 expressed in E. coli as the immunogen.H-SAAMAETLQ-OH
H-SAAMAETLQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SAAMAETLQ-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SAAMAETLQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SAAMAETLQ-OH at the technical inquiry form on this pagePurity:Min. 95%ACCN5 antibody
ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDCACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5063Purity:Min. 95%H-VITAFNDGLNHLDSLK^-OH
Peptide H-VITAFNDGLNHLDSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VITAFNDGLNHLDSLK^-OH include the following: Evaluating cPILOT Data toward Quality Control Implementation BL Bowser, KL Patterson - Journal of the American , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.3c00179
