Peptides

Semaglutide Acetate is an agonist of a glucagon-like peptide 1 (GLP-1) receptor and can be used in studies about the treatment of type 2 diabetes.

A synthetic peptide for use as a blocking control in assays to test for specificity of CTTN antibody, catalog no. 70R-2725

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5813

A synthetic peptide for use as a blocking control in assays to test for specificity of CCL5 antibody, catalog no. 20R-1137

Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-RIIYDRKFLMECRN-NH2 include the following: Consideration of binding kinetics in the design of stapled peptide mimics of the disordered proteins eukaryotic translation initiation factor 4E-binding protein 1 and EE Gallagher, JM Song, A Menon - Journal of medicinal , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.9b00068 Crystallographic and mass spectrometric characterisation of eIF4E with N7-alkylated cap derivatives CJ Brown , I McNae , PM Fischer - Journal of molecular , 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283607008261

A synthetic peptide for use as a blocking control in assays to test for specificity of NPTN antibody, catalog no. 70R-7282

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of TTYH1 antibody, catalog no. 70R-6815

Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 include the following: Purification and in vitro functional analyses of RGS12 and RGS14 GoLoco motif peptides RJ Kimple , FS Willard , DP Siderovski - Methods in enzymology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687904900262

Catalogue peptide; min. 95% purity

This is an N-terminal fragment of beta amyloid.

Peptide H-TPEELFHPLGADSQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPEELFHPLGADSQV-OH include the following: Two glucose transporter isoforms are sorted differentially and are expressed in distinct cellular compartments Y Shibasaki, T Asano, JL Lin, K Tsukuda - Biochemical , 1992 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/281/3/829/27558 A synthetic peptide corresponding to the GLUT4 C-terminal cytoplasmic domain causes insulin-like glucose transport stimulation and GLUT4 recruitment in rat W Lee, CY Jung - Journal of Biological Chemistry, 1997 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)65773-X/abstract Rabbit brain glucose transporter responds to insulin when expressed in insulin-sensitive Chinese hamster ovary cells T Asano, Y Shibasaki, S Ohno , H Taira, JL Lin - Journal of Biological , 1989 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)94083-4/abstract Expression of the GLUT1 glucose transporter increases thymidine uptake in Chinese hamster ovary cells at low glucose concentrations T Asano, Y Shibasaki, JL Lin, K Tsukuda, H Katagiri - Cancer research, 1991 - AACRhttps://aacrjournals.org/cancerres/article-abstract/51/16/4450/496968 Reticulocyte and red blood cell deformation triggers specific phosphorylation events PL Moura , MA Lizarralde Iragorri , O Franaca - Blood , 2019 - ashpublications.orghttps://ashpublications.org/bloodadvances/article-abstract/3/17/2653/261383 Site-directed mutagenesis of GLUT1 in helix 7 residue 282 results in perturbation of exofacial ligand binding. M Hashiramoto, T Kadowaki, AE Clark - Journal of Biological , 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S002192581937070X Regulation of glucose transport by angiotensin II and glucose in cultured vascular smooth muscle cells LA Quinn, WD McCumbee - Journal of cellular physiology, 1998 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-4652(199810)177:1%3C94::AID-JCP10%3E3.0.CO;2-N The regulation of glucose transport in cultured vascular smooth muscle cells by angiotensin II and glucose LA Quinn - 1997 - search.proquest.comhttps://search.proquest.com/openview/fd00c729197a30f666933921db3689a4/1?pq-origsite=gscholar&cbl=18750&diss=y

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of UNG antibody, catalog no. 70R-10266

Angiotensin Heavy Tryptic Peptide Standard f use in protein identification and quantitation studies. Angiotensin is a peptide hormone that causes vasoconstriction and is responsible for an increase in blood pressure. Furthermore angiotensin stimulates aldosterone release.

Peptide Fluor-SDKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Fluor-SDKP-OH include the following: Effects of a novel peptide Ac-SDKP in radiation-induced coronary endothelial damage and resting myocardial blood flow UC Sharma , SD Sonkawade , A Baird , M Chen, S Xu - Cardio-Oncology, 2018 - Springerhttps://link.springer.com/article/10.1186/s40959-018-0034-1 Novel anti-inflammatory mechanisms of N-Acetyl-Ser-Asp-Lys-Pro in hypertension-induced target organ damage U Sharma , NE Rhaleb , S Pokharel - American Journal , 2008 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpheart.00305.2007 Prolyl oligopeptidase induces angiogenesis both in vitro and in vivo in a novel regulatory manner TT Myöhanen , J Tenorio-Laranga - British journal of , 2011 - Wiley Online Libraryhttps://bpspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1476-5381.2010.01146.x N-Acetyl-Seryl-Aspartyl-Lysyl-Proline (Ac-SDKP) Delays the Development of Hypertension and Renal Damage in Systemic Lupus Erythematosus (SLE) P Nakagawa, TD Liao, M Worou, H Basha - The FASEB , 2015 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fasebj.29.1_supplement.667.7 Decreased endogenous levels of Ac-SDKP promote organ fibrosis MA Cavasin, TD Liao, XP Yang, JJ Yang - , 2007 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/hypertensionaha.106.084103 On-line solid-phase extraction LC-MS/MS for the determination of Ac-SDKP peptide in human plasma from hemodialysis patients K Inoue, A Ikemura, Y Tsuruta - Biomedical , 2012 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/bmc.1636 Synthesis and biological evaluation of analogues of the tetrapeptide N-acetyl-Ser-Asp-Lys-Pro (AcSDKP), an inhibitor of primitive haematopoietic cell proliferation J Thierry, C Grillon , S Gaudron, P Potier - Journal of Peptide , 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.322 Hunting for peptide substrates of prolyl oligopeptidase: classical versus non-classical bioactive peptides J Tenorio-Laranga , PT Mannisto - CNS & Neurological , 2011 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cnsnddt/2011/00000010/00000003/art00006 A Quality by Design Approach Towards a Simple and Novel HPLC-UV Method for Quantification of the Antifibrotic Peptide N-Acetyl-Seryl-Aspartyl-Lysyl-Proline H Ho, S Sembi, S Abukhamees, R Day - Available at SSRN - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=3990207

Peptide H-LLIYDTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLIYDTSK-OH include the following: Mass spectrometry provides a highly sensitive noninvasive means of sequencing and tracking M-protein in the blood of multiple myeloma patients Z McDonald, P Taylor, M Liyasova - Journal of Proteome , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.0c01022 Quantitative analysis of antibody survival across the infant digestive tract using mass spectrometry with parallel reaction monitoring BJ Kim , J Lueangsakulthai , BNP Sah , B Scottoline - Foods, 2020 - mdpi.comhttps://www.mdpi.com/2304-8158/9/6/759

A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD7 antibody, catalog no. 70R-5085