Produits biochimiques et réactifs

Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.

H-ERFAFNPGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ERFAFNPGL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ERFAFNPGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ERFAFNPGL-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM12 antibody, catalog no. 70R-5030

Mouse monoclonal CDK2 antibody

Rabbit polyclonal CD249 antibody (HRP)

Chloromethylated polystyrene resin (CMSR) is a chemical that is used in the synthesis of organic chemicals. It has been shown to have a higher reactivity than polystyrene resin, which leads to shorter reaction times and increased yields. Reaction solution containing CMSR and hydrogen fluoride are used for the synthesis of amides from nitrobenzene, aniline, formaldehyde, and ammonia. This chemical also has been shown to be effective against cancer cells in tissue culture studies. Chloromethylated polystyrene resin reacts with redox potentials such as pyrazole rings or fluorescence probes to produce a fluorescent product. This type of reaction can be used in vitro assays or biological studies as well as other applications.

Purified recombinant LGALS1 protein (His tag)

Purified recombinant Homer1 protein (His tag)

Rabbit anti-chicken IgG (HRP) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.

Purified native Human Ferritin protein

A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC5 antibody, catalog no. 70R-3326

A synthetic peptide for use as a blocking control in assays to test for specificity of ELAC1 antibody, catalog no. 70R-3138

Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria. Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains. Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines. Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.

[Sulfo-Cyanine3]-LifeAct (Abp140 1-17) contains the fluorophore sulfo-cyanine3 and the 17 amino acid peptide lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. One application of lifeact is in the study of plant development and pathogen defence as filamentous actin within the plant's actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements. The addition of Atto655 which has single molecule (SM) imaging properties allows the location of lifeAct (Abp140 1-17) binding to be detected.

NAGK antibody was raised in Rabbit using Human NAGK as the immunogen

Please enquire for more information about 4-Dehydroxy-4-amino ezetimibe including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal MAP3K1 antibody

H-NMWQEVGKAMYAPPI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NMWQEVGKAMYAPPI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NMWQEVGKAMYAPPI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NMWQEVGKAMYAPPI-OH at the technical inquiry form on this page

Rabbit polyclonal ERP29 antibody (HRP)

A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA6 antibody, catalog no. 70R-5434

It is a key player in the Glucose-Alanine cycle, which enables the removal of pyruvate and glutamate from muscle to the liver. The Glucose-Alanine cycle aides to conserve ATP in muscle for muscle contraction, while the energy burden of gluconeogenesis is imposed upon the liver. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

IL4 antibody was raised in rabbit using highly pure recombinant rat IL-4 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL10 antibody, catalog no. 70R-2443

Alpha-Casozepine (alpha-CZP) is a tryptic hydrolysate of bovine milk alphas1-casein. The presence of bile salts facilitates alpha-CZP absorption through a Caco2 monolayer. alpha-CZP shows similarities to benzodiazepines with its anxiolytic-like activity but lack the common side effects of habituation or sedation. alpha-CZP binds to the GABAA receptor at the benzodiazepine site.  alpha-CZP binds with a significantly lower affinity than benzodiazepines.Intraperitoneal administration of Alpha-Casozepine (alpha-CZP) to rodents results in anticonvulsant and sleep-protecting effects. Human administration reduces physiological stress symptoms in stressed and control patients. alpha-CZP modulated neuronal activity in brain regions linked to anxiety regulation in mice.

H-EGAVVIQDNNEIKVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGAVVIQDNNEIKVV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGAVVIQDNNEIKVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGAVVIQDNNEIKVV-OH at the technical inquiry form on this page

H-QDCRFRVTQLPNGRDFHMSV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QDCRFRVTQLPNGRDFHMSV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QDCRFRVTQLPNGRDFHMSV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QDCRFRVTQLPNGRDFHMSV-OH at the technical inquiry form on this page

Rabbit polyclonal ABHD12B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TSKS antibody, catalog no. 70R-2687

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS12IP1 antibody, catalog no. 70R-2463

Goat anti-Guinea Pig IgG (H + L) (HRP) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.

Rabbit polyclonal SOX13 antibody

The Vitronectin antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets vitronectin, a protein complex involved in various biological processes. By binding to vitronectin, this antibody can be used for research purposes such as immunohistochemistry and western blotting to study the localization and expression levels of vitronectin in different tissues and cell types. In addition, the Vitronectin antibody has potential applications in the development of therapeutic drugs. Vitronectin is known to play a role in adipose tissue function and vasoactive intestinal peptide signaling, making it an interesting target for drug discovery. By blocking or modulating the activity of vitronectin using this antibody, researchers can explore its potential as a target for the treatment of multidrug-resistant diseases or disorders related to dopamine metabolism. This high-quality monoclonal antibody has been extensively tested and validated for its specificity and sensitivity. It offers researchers a reliable tool to study

A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL6 antibody, catalog no. 70R-7855

The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry. In addition to its diagnostic applications, the PSA antibody has also been studied for its potential therapeutic uses. It has been found to have anti-angiogenic properties, meaning it can inhibit the formation of new blood vessels that are necessary for tumor growth and metastasis. This makes it a promising candidate for anti-cancer therapies. Furthermore, the PSA antibody has shown cytotoxic effects on cancer cells expressing high levels of PSA. It can induce cell death through various mechanisms, including apoptosis or immune-mediated mechanisms. These findings suggest that the PSA antibody may have potential as a targeted therapy for prostate cancer.

Rabbit polyclonal NFkB antibody (Regulatory Factor)

7α,24(R/S)-Dihydroxycholesterol-d7 is a research tool used in cell biology and pharmacology. It is an activator of the Ligand Receptor Interaction (LRI) assay, which can be used to identify ligands for many receptors. 7α,24(R/S)-Dihydroxycholesterol-d7 binds to the LRI receptor and induces conformational changes in the receptor protein that can be detected by spectroscopy. The compound has been shown to inhibit ion channels, such as nicotinic acetylcholine receptors and voltage-gated potassium channels. This inhibitor also inhibits protein synthesis by binding to ribosomes.

Peptide corresponding to residues 206-214 of murine islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP), the autoantigen targeted by pathogenic CD8+ T cells in non obese diabetic (NOD) mice. Cells that recognize IGRP(206-214) are present in the earliest islet infiltrates of NOD mice and undergo avidity maturation as islet inflammation progresses to overt disease.

Macropa-NH2 diester is a synthetic, non-peptidic ligand that binds to the extracellular domain of the human muscarinic acetylcholine receptor M3. It was developed as a research tool to study protein interactions and cellular signaling. Macropa-NH2 diester is used in pharmacology and cell biology studies to investigate protein interactions, such as with antibodies or ion channels. This compound is also used as an activator in cell culture experiments and can be used to inhibit receptors or downstream signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN2 antibody, catalog no. 70R-2130

MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

26S Proteasome P52 Subunit antibody was raised in mouse using 26S proteasomes purified from Xenopus laevis ovary as the immunogen.

Recombinant human GPD1L protein (His tag)

H-FDMELDDLPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FDMELDDLPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FDMELDDLPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FDMELDDLPK-OH at the technical inquiry form on this page

Purified Native Clostridium difficile Toxin A protein (ribotype 027)

LP 922056 is a drug that inhibits the dopamine transporter and has been shown to be effective in treating Parkinson's disease. It has also been shown to be effective in treating osteoporosis and osteopenia, which are characterized by low bone mineral density and increased risk of fracture. LP 922056 increases bone mineral density by inhibiting the reuptake of dopamine from the synapse, thereby increasing dopamine levels in the brain. This increase in dopamine levels stimulates new bone formation and leads to an increase in bone mineral density.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Applications 3,3-Diethoxypropionitrile is a propionitrile derivative used in the preparation of various biologically active compounds such as p38α mitogen-activated protein kinase inhibitors. References Goldstein, D.M. et al.: J. Med. Chem., 54, 2255 (2011);

B-Raf kinase inhibitor

Rab11B antibody was raised in Rat using Mouse RAB11B and GST fusion protein as the immunogen.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

M13 phage antibody (biotin) was raised in mouse using fd phages from E. coli F+ strain as the immunogen.

Rabbit polyclonal RRP1 antibody

This Monoclonal anti-Estradiol antibody is suitable for ELISA and LFD applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of Cyb5r1 antibody, catalog no. 70R-8676

Please enquire for more information about BNP-32 (Rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Vegfb

Purified recombinant RABL5 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of TACC3 antibody, catalog no. 70R-4547

Rabbit polyclonal VEGFA antibody (FITC)

Please enquire for more information about Peanut Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

H-VPLDKEFRKYTAFTI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VPLDKEFRKYTAFTI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VPLDKEFRKYTAFTI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VPLDKEFRKYTAFTI-OH at the technical inquiry form on this page

The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens. In research settings, the HBcAg antibody is often utilized for immunohistochemistry, immunofluorescence, and Western blotting experiments. It can be used to detect the presence of specific proteins or markers in various samples such as human serum or tissue sections. Furthermore, this antibody has been proven to have catalase-like activity, making it a valuable tool for studying oxidative stress and related processes. Its ability to bind to streptavidin also allows for easy conjugation with other molecules such as fluorescent dyes or enzymes, expanding its applications even further. The HBcAg antibody has shown promise in the field of cancer research, particularly in targeting HER

SM 6586 is a dihydropyridine calcium antagonist that inhibits the entry of extracellular calcium into cells. It blocks the influx of calcium ions by blocking voltage-gated L-type calcium channels in smooth muscle cells and neurons. SM 6586 also interacts with other drugs. For example, it has been shown to inhibit the uptake of isradipine by rat brain synaptosomes and prevent isradipine from binding to its target site on the cell membrane. This drug also inhibits the transport of lysine analogs into cells, which may be due to its ability to inhibit cationic amino acid transporter activity. SM 6586 has been shown to have an inhibitory effect on cerebral blood flow in both carotid arteries and ophthalmic veins. The mechanism behind this effect is not yet known.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF41 antibody, catalog no. 70R-8765

H-TNWPGFGQGTK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TNWPGFGQGTK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TNWPGFGQGTK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TNWPGFGQGTK-OH at the technical inquiry form on this page

UNG antibody was raised in rabbit using the C terminal of UNG as the immunogen

Purified Polyclonal ETAA1 antibody

Noggin Mouse is a protein that is secreted by the mouse brain. It is a member of the transforming growth factor-beta superfamily and is involved in development, cell differentiation, and immune regulation. Noggin Mouse has been shown to inhibit cytokine production by E. coli and other bacterial strains. Noggin Mouse also inhibits the release of proinflammatory cytokines from macrophages and synoviocytes.

A synthetic peptide for use as a blocking control in assays to test for specificity of MKNK1 antibody, catalog no. 70R-10044

Affinity purified Rabbit polyclonal RASA3 antibody

Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.

CWHM-12 is a molecule that inhibits the production of epidermal growth factor, which is an inflammatory molecule in the body. It has been shown to have beneficial effects on bowel disease, rotator, hepatic steatosis, autoimmune diseases, kidney fibrosis and cardiac diseases. CWHM-12 also binds to integrin receptors on liver cells and blocks the activation of these cells by inflammatory molecules. This drug has been shown to be effective against collagenase activity in vitro and in vivo models.

HBB antibody was raised in Rabbit using Human HBB as the immunogen

Plasmodium falciparum histidine rich protein 2 (PfHRP2) is secreted in substantial amounts by the parasite into the host blood. This is a highly purified HIS tagged recombinant protein that is derived from E.coli.

Mouse monoclonal LENG1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RMI1 antibody, catalog no. 70R-5555

Please enquire for more information about Efaproxiral sodium including the price, delivery time and more detailed product information at the technical inquiry form on this page

4-Methylumbelliferyl β-D-cellotrioside

IL2 antibody was raised in mouse using highly pure recombinant rat IL-2 as the immunogen.

The uPAR antibody is a monoclonal antibody that has cytotoxic properties and is used as a medicament in multidrug therapy. It targets the plasminogen activator receptor (uPAR) on the surface of cells, inhibiting its function and preventing the activation of collagen-degrading enzymes such as urokinase plasminogen activator (uPA). This antibody has been shown to be effective in treating various diseases and conditions, including cancer, thrombocytopenia, and alpha-fetoprotein-related disorders. In the field of Life Sciences, uPAR antibodies are widely used for research purposes, such as studying cell signaling pathways and growth factors. Whether you need a polyclonal or monoclonal antibody, our high-quality uPAR antibodies are designed to meet your specific research needs.

Rabbit polyclonal UQCRQ antibody (biotin)

H-ADSNPRGVSAYLSRPSPGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ADSNPRGVSAYLSRPSPGGC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ADSNPRGVSAYLSRPSPGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ADSNPRGVSAYLSRPSPGGC-OH at the technical inquiry form on this page

FAM113A antibody was raised using the N terminal of FAM113A corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC

Rabbit polyclonal p57 Kip2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SF4 antibody, catalog no. 70R-4979