Produits biochimiques et réactifs

TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Peptide H-SIIGFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SIIGFEKL-OH include the following: Mini-intronic plasmid vaccination elicits tolerant LAG3+ CD8+ T cells and inferior antitumor responses VT Colluru , CD Zahm , DG McNeel - Oncoimmunology, 2016 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/2162402X.2016.1223002 Suboptimal T-cell receptor signaling compromises protein translation, ribosome biogenesis, and proliferation of mouse CD8 T cells TCJ Tan , J Knight , T Sbarrato - Proceedings of the , 2017 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1700939114 Interferon-γ and interleukin-4 reciprocally regulate CD8 expression in CD8+ T cells SH Apte , A Baz, P Groves, A Kelso - Proceedings of the , 2008 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0809549105 The tyrosine phosphatase PTPN22 discriminates weak self peptides from strong agonist TCR signals RJ Salmond , RJ Brownlie, VL Morrison - Nature , 2014 - nature.comhttps://www.nature.com/articles/ni.2958 Mechanistic target of rapamycin complex 1/S6 kinase 1 signals influence T cell activation independently of ribosomal protein S6 phosphorylation RJ Salmond , RJ Brownlie, O Meyuhas - The Journal of , 2015 - journals.aai.orghttps://journals.aai.org/jimmunol/article/195/10/4615/104772 Alteration of Cell Surface Sialylation RAIN CD - J Immunol, 2004 - academia.eduhttps://www.academia.edu/download/47694451/275.full.pdf Altered peptide ligands induce delayed CD8-T cell receptor interaction-a role for CD8 in distinguishing antigen quality PP Yachi, J Ampudia, T Zal , NRJ Gascoigne - Immunity, 2006 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(06)00318-9.pdf Cytotoxic immunological synapses do not restrict the action of interferon-γ to antigenic target cells NSR Sanderson, M Puntel - Proceedings of the , 2012 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1116058109 The strength of T cell receptor signal controls the polarization of cytotoxic machinery to the immunological synapse MR Jenkins , A Tsun , JC Stinchcombe, GM Griffiths - Immunity, 2009 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(09)00412-9.pdf IL-12 enhances CTL synapse formation and induces self-reactivity MA Markiewicz , EL Wise, ZS Buchwald - The Journal of , 2009 - journals.aai.orghttps://journals.aai.org/jimmunol/article/182/3/1351/83625 The half-life of the T-cell receptor/peptide-major histocompatibility complex interaction can modulate T-cell activation in response to bacterial challenge LJ Carre , SM Bueno , P Bull, SG Nathenson - , 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2567.2007.02561.x Targeted calcium influx boosts cytotoxic T lymphocyte function in the tumour microenvironment KD Kim, S Bae , T Capece, H Nedelkovska - Nature , 2017 - nature.comhttps://www.nature.com/articles/ncomms15365 Stored Fas ligand, a mediator of rapid CTL-mediated killing, has a lower threshold for response than degranulation or newly synthesized Fas ligand JS He, DE Gong, HL Ostergaard - The journal of immunology, 2010 - journals.aai.orghttps://journals.aai.org/jimmunol/article/184/2/555/111850 JNK2 negatively regulates CD8+ T cell effector function and anti-tumor immune response J Tao, Y Gao, MO Li , W He, L Chen - European journal of , 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200636726 Contractile actomyosin arcs promote the activation of primary mouse T cells in a ligand-dependent manner J Hong , S Murugesan, E Betzig, JA Hammer - PLoS One, 2017 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0183174 Cbl-b mitigates the responsiveness of naive CD8+ T cells that experience extensive tonic T cell receptor signaling J Eggert, WM Zinzow-Kramer , Y Hu , EM Kolawole - Science , 2024 - science.orghttps://www.science.org/doi/abs/10.1126/scisignal.adh0439 CD69 does not affect the extent of T cell priming E Alari-Pahissa, L Notario, E Lorente , J Vega-Ramos - PLoS , 2012 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0048593 LPA5 is an inhibitory receptor that suppresses CD8 T-cell cytotoxic function via disruption of early TCR signaling D Mathew , KN Kremer, P Strauch, G Tigyi - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2019.01159 Vaccination with High-Affinity Epitopes Impairs Antitumor Efficacy by Increasing PD-1 Expression on CD8+ T Cells CD Zahm , VT Colluru , DG McNeel - Cancer immunology research, 2017 - AACRhttps://aacrjournals.org/cancerimmunolres/article-abstract/5/8/630/468807 Alteration of cell surface sialylation regulates antigen-induced naive CD8+ T cell responses BP Pappu, PA Shrikant - The Journal of Immunology, 2004 - journals.aai.orghttps://journals.aai.org/jimmunol/article/173/1/275/72999 ESCRT-mediated membrane repair protects tumor-derived cells against T cell attack AT Ritter , G Shtengel , CS Xu , A Weigel , DP Hoffman - Science, 2022 - science.orghttps://www.science.org/doi/abs/10.1126/science.abl3855 CD3 aptamers promote expansion and persistence of tumor-reactive T cells for adoptive T cell therapy in cancer AP Menon, H Villanueva, D Meraviglia-Crivelli - Therapy-Nucleic Acids, 2024 - cell.comhttps://www.cell.com/molecular-therapy-family/nucleic-acids/fulltext/S2162-2531(24)00085-4 Alkylating chemotherapy may exert a uniquely deleterious effect upon neo-antigen-targeting anticancer vaccination AJ Litterman , AZ Dudek , DA Largaespada - Oncoimmunology, 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/onci.26294 Affinity thresholds for naive CD8+ CTL activation by peptides and engineered influenza A viruses AE Denton , R Wesselingh , S Gras - The Journal of , 2011 - journals.aai.orghttps://journals.aai.org/jimmunol/article/187/11/5733/85366 Hyperglycaemia does not affect antigen-specific activation and cytolytic killing by CD8+ T cells in vivo A Recino, K Barkan, FS Wong , G Ladds - Bioscience , 2017 - portlandpress.comhttps://portlandpress.com/bioscirep/article-abstract/37/4/BSR20171079/57449 N-hydroxy-amide analogues of MHC-class I peptide ligands with nanomolar binding affinities A Bianco , C Zabel, P Walden - of the European Peptide , 1998 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1099-1387(199812)4:8%3C471::AID-PSC166%3E3.0.CO;2-8

Region of FGF basic protein corresponding to amino acids PALPEDGGGA FPPGHFKDPK RLYCKNGGFF LRIHPDGRVD GVREKSDPHV KLQLQAEERG VVSIKGVCAN RYLAMKEDGR LLASKCVTEE CFFFERLESN NYNTYRSRKY SSWYVALKRT GQYKLGSKTG PGQKAILFLP MSAKS.

Rabbit polyclonal PANK2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRR1 antibody, catalog no. 70R-5216

Rabbit polyclonal EGFR antibody

IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF

Rabbit polyclonal ETV4 antibody

Rabbit polyclonal p70 antibody

4-[2-(Boc-amino)ethyl]aniline is used as a intermediate for chemical research. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPAB antibody, catalog no. 70R-1475

Stoffel Fragment DNA Polymerase

36-509 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMADQ PIDADVTVIG SGPGGYVAAI KAAQLGFKTV CIEKNETLGG TCLNVGCIPS KALLNNSHYY HMAHGKDFAS RGIEMSEVRL NLDKMMEQKS TAVKALTGGI AHLFKQNKVV HVNGYGKITG KNQVTATKAD GGTQVIDTKN ILIATGSEVT PFPGITIDED TIVSSTGALS LKKVPEKMVV IGAGVIGVEL GSVWQRLGAD VTAVEFLGHV GGVGIDMEIS KNFQRILQKQ GFKFKLNTKV TGATKKSDGK IDVSIEAASG GKAEVITCDV LLVCIGRRPF TKNLGLEELG IELDPRGRIP VNTRFQTKIP NIYAIGDVVA GPMLAHKAED EGIICVEGMA GGAVHIDYNC VPSVIYTHPE VAWVGKSEEQ LKEEGIEYKV GKFPFAANSR AKTNADTDGM VKILGQKSTD RVLGAHILGP GAGEMVNEAA LALEYGASCE DIARVCHAHP TLSEAFREAN LAASFGKSIN F

Peptide H-TLSDYNIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TLSDYNIQK-OH include the following: Large-Scale Profiling of Unexpected Tryptic Cleaved Sites at Ubiquitinated Lysines Z Sun, W Xiao, N Li, L Chang, P Xu - Journal of Proteome , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.2c00748 Gas-phase amidation of carboxylic acids with Woodward's reagent K ions Z Peng, AL Pilo , CA Luongo - Journal of The American , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-015-1209-8 Ubiquitination-mediated molecular pathway alterations in human lung squamous cell carcinomas identified by quantitative ubiquitinomics X Zhan, M Lu, L Yang, J Yang, X Zhan - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fendo.2022.970843/full Solid-phase N-terminal peptide enrichment study by optimizing trypsin proteolysis on homoarginine-modified proteins by mass spectrometry SM Chowdhury , GR Munske, J Yang - Rapid , 2014 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.6820 Protein standard absolute quantification (PSAQ) method for the measurement of cellular ubiquitin pools SE Kaiser , BE Riley, TA Shaler, RS Trevino - Nature , 2011 - nature.comhttps://www.nature.com/articles/nmeth.1649 Targeted mass spectrometric strategy for global mapping of ubiquitination on proteins S Mollah, IE Wertz, Q Phung, D Arnott - Journal Devoted to , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3227 Cross-linking electrochemical mass spectrometry for probing protein three-dimensional structures Q Zheng, H Zhang , L Tong, S Wu , H Chen - Analytical chemistry, 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac501526n A tyrosine, histidine-selective bifunctional cross-linker for protein structure analysis Q Yan, M Li, Y Zhang, H Liu, F Liu , W Liao, Y Wang - Talanta, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914023001728 Enhanced detection of ubiquitin isopeptides using reductive methylation N Chicooree, Y Connolly, CT Tan , A Malliri - Journal of The , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-012-0538-0 Multiple proteases to localize oxidation sites L Gu , RAS Robinson - Plos one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0116606 Ion/ion reactions of MALDI-derived peptide ions: increased sequence coverage via covalent and electrostatic modification upon charge inversion JR Stutzman , SA McLuckey - Analytical chemistry, 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac302374p Dissociation behavior of tryptic and intramolecular disulfide-linked peptide ions modified in the gas phase via ion/ion reactions JR Stutzman , KM Hassell, SA McLuckey - International journal of mass , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380611002569 The use of ubiquitin lysine mutants to characterize E2-E3 linkage specificity: Mass spectrometry offers a cautionary"tail" JH Hong, D Ng, T Srikumar , B Raught - Proteomics, 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201500058 Methods to measure ubiquitin chain length and linkage F Ohtake, H Tsuchiya, K Tanaka , Y Saeki - Methods in enzymology, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687918305159 Quantitative analysis of in vitro ubiquitinated cyclin B1 reveals complex chain topology DS Kirkpatrick , NA Hathaway , J Hanna, S Elsasser - Nature cell , 2006 - nature.comhttps://www.nature.com/articles/ncb1436 Identification of ubiquitin nitration and oxidation using a liquid chromatography/mass selective detector system D Yi, PD Perkins - Journal of Biomolecular Techniques: JBT, 2005 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC2291747/

Peptide H-RYRPGTVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RYRPGTVAL-OH include the following: Structural plasticity of KIR2DL2 and KIR2DL3 enables altered docking geometries atop HLA-C S Moradi , S Stankovic, GM O'connor, P Pymm - Nature , 2021 - nature.comhttps://www.nature.com/articles/s41467-021-22359-x Computational perspectives revealed prospective vaccine candidates from five structural proteins of novel SARS corona virus 2019 (SARS-CoV-2) R Anand , S Biswal, R Bhatt, BN Tiwary - PeerJ, 2020 - peerj.comhttps://peerj.com/articles/9855/ Stimulating T cell responses against patient-derived breast cancer cells with neoantigen peptide-loaded peripheral blood mononuclear cells N Sueangoen , H Grove , N Chuangchot - Cancer Immunology , 2024 - Springerhttps://link.springer.com/article/10.1007/s00262-024-03627-3 Differential binding to HLA-C of p50-activating and p58-inhibitory natural killer cell receptors M Vales-Gomez , HT Reyburn - Proceedings of the , 1998 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.95.24.14326 Kinetics of interaction of HLA-C ligands with natural killer cell inhibitory receptors M Vales-Gomez , HT Reyburn, M Mandelboim - Immunity, 1998 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(00)80616-0.pdf Killer cell immunoglobulin receptors and T cell receptors bind peptide-major histocompatibility complex class I with distinct thermodynamic and kinetic properties K Maenaka, T Juji, T Nakayama, JR Wyer - Journal of Biological , 1999 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)52054-3/abstract Molecular recognition by Ig-like receptors, KIRs and FcγRs K Maenaka, PA van der Merwe , DI Stuart - Activating and Inhibitory , 2001 - Springerhttps://link.springer.com/chapter/10.1007/978-4-431-53940-7_6 NK cells: tuned by peptide? J Das , SI Khakoo - Immunological reviews, 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/IMR.12315 This is an Open Access document downloaded from ORCA, Cardiff University's institutional repository: http://orca. cf. ac. uk/102240/This is the author's version G Kaur, S Gras , JI Mobbs , JP Vivian , A Cortes, T Barber - academia.eduhttps://www.academia.edu/download/73482284/Structural_20regulatory_20diversity_20_20_20J_20Rossjohn-Kaur.pdf Structural and regulatory diversity shape HLA-C protein expression levels G Kaur, S Gras , JI Mobbs , JP Vivian , A Cortes - Nature , 2017 - nature.comhttps://www.nature.com/articles/ncomms15924 21-Hydroxylase-specific CD8+ T cells in autoimmune Addison's disease are restricted by HLA-A2 and HLA-C7 molecules A Hellesen, S Aslaksen, L Breivik , EC Royrvik - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2021.742848/full

Affinity purified Rabbit polyclonal MCM2 antibody

Mouse monoclonal TdT antibody

Sheep Red Blood Cells (SRBC) are widely used in veterinary applications for various assays and tests. These cells contain fatty acids, anti-HBs antibodies, and other components that make them suitable for different diagnostic purposes. SRBC can be used in immunohistochemistry to detect specific antigens or monoclonal antibodies. They are also commonly used in experiments to measure the activity of cyclase-activating proteins or the production of interferon-gamma (IFN-gamma). Additionally, SRBC have low density, which makes them ideal for certain experimental procedures. Whether you need them for research or clinical applications, Sheep Red Blood Cells provide a reliable and versatile tool for a wide range of veterinary applications.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Gephyrin antibody was raised using the middle region of GPHN corresponding to a region with amino acids GEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEV

Mouse monoclonal CD1a antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IL22RA1 antibody, catalog no. 70R-6373

ELISA kit for detection of Thyroxine in the research laboratory

Ac-FTANDSGPRRYC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-FTANDSGPRRYC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-FTANDSGPRRYC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-FTANDSGPRRYC-NH2 at the technical inquiry form on this page

Rabbit Polyclonal KCNB1 antibody (Ser567)

Murashige Cattleya Orchid Multiplication Medium

A serotonin reuptake inhibitor with anticholinergic activity and mild inhibitory activity on noradrenaline reuptake. Paroxetine has been used for the treatment of depression, anxiety disorders, post-traumatic stress disorder, premenstrual dysphoric disorder and obsessive-compulsive disorder.  Also inhibits nitric oxide synthase and cytochrome isoenzyme P450 2D6.

CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

Rabbit polyclonal RORA antibody

Mouse monoclonal TTC32 antibody

Purified recombinant Hepatitis C Virus Nucleocapsid p22 protein

PSA antibody was raised in mouse using human PSA as the immunogen.

Peptide H-DGQLTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DGQLTIK^-OH include the following: Deciphering the role of exosomes in tuberculosis NA Kruh-Garcia , LM Wolfe, KM Dobos - Tuberculosis, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1472979214205671

Rabbit polyclonal IRX3 antibody

Mouse CTNI(Cardiac Troponin-I) ELISA Kit

Dilution and stabilization buffer for monoclonal or polyclonal antibody HRP conjugates

Non bleeding sticks pH 7.0-14.0 (gradation 0.5)

A synthetic peptide for use as a blocking control in assays to test for specificity of CHIC2 antibody, catalog no. 70R-6863

A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf201 antibody, catalog no. 70R-4814

H-SLMEHWALGA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLMEHWALGA-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLMEHWALGA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLMEHWALGA-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of PGK2 antibody, catalog no. 70R-2323

Peptide H-KILLARLFLYALALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KILLARLFLYALALL-OH include the following: The generation and characterization of LMP2-specific CTLs for use as adoptive transfer from patients with relapsed EBV-positive Hodgkin disease CM Bollard , KCM Straathof , MH Huls - Journal of , 2004 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2004/07000/The_Generation_and_Characterization_of.00008.aspx

TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT

This mouse monoclonal antibody targets the dengue virus envelope protein. The envelope protein is made up of the three domains, I, II and III and is involved in host cell receptor-mediated endocytosis and fusion. Domain II and III are primary targets for neutralizing antibody formation and so an ideal target for vaccine and treatment development.The Dengue virus causes the human disease, dengue fever. The dengue virus was first isolated by Ren Kimura and Susuma Hotta while studying blood samples of patients taken during the 1943 dengue epidemic in Nagasaki, Japan. It is transmitted to humans primarily via the Aedes aegypti and Aedes albopicto female mosquitoes which acquire the virus while feeding on the blood of an infected person. Although this virus can inflict asymptomatic or mild symptoms in patients, it can lead to severe infectious such as dengue hemorrhagic fever, also known as dengue shock syndrome.

H-GLSDYYYRALANK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLSDYYYRALANK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLSDYYYRALANK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLSDYYYRALANK-NH2 at the technical inquiry form on this page

IRF9 antibody was raised in Rabbit using Human IRF9 as the immunogen

Rabbit anti-sheep IgG (H+L) was raised in rabbit using sheep IgG whole molecule as the immunogen.

Peptide H-SRPLIHFGSDYEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SRPLIHFGSDYEDR-OH include the following: Monoclonal antibody F89/160.1. 5 defines a conserved epitope on the ruminant prion protein KI O'Rourke, TV Baszler , JM Miller - Journal of Clinical , 1998 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jcm.36.6.1750-1755.1998

H-DLIETYFVSPTLFRVIRC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DLIETYFVSPTLFRVIRC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DLIETYFVSPTLFRVIRC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DLIETYFVSPTLFRVIRC-OH at the technical inquiry form on this page

Human sequence expressed in sf Insect Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

Please enquire for more information about Purified Hu NfL Detecting Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of EVX1 antibody, catalog no. 70R-9566

Mouse monoclonal PPP5C antibody

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

NT5M antibody was raised using the N terminal of NT5M corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2 antibody, catalog no. 70R-10293

Rabbit polyclonal cRAF antibody

Region of RANK protein corresponding to amino acids PAMMEGSWLD VARRGKPEAQ PFAHLTINAA DIPSGSHKVS LSSWYHDRGW AKISNMTLSN GKLRVNQDGF YYLYANICFR HHETSGSVPA DYLQLMVYVV KTSIKIPSSH NLMKGGSTKN WSGNSEFHFY SINVGGFFKL RAGEEISVQV SNPSLLDPDQ DATYFGAFKV QDID.

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT84 antibody, catalog no. 70R-3002

Potent and selective GSK3-β inhibitor, with IC50 value of 48 nM. Increases Nanog expression and regulates self-renewal in murine embryonic stem cells (ESCs). Induces reprograming of induced pluripotent stem cells (iPSCs) to derive cells from specific lineages.

(S)-1-Cyclohexyl-4-(4-(2-methoxyphenyl)piperazin-1-yl)-2-methyl-2-phenylbutan-1-one is a selective serotonin reuptake inhibitor that has shown efficacy in animal models of depression. It acts by binding to the 5HT1A and 5HT2C receptors, which are located in the brain. This drug also blocks dopamine reuptake and increases the release of serotonin in the brain, leading to an antidepressant effect. (S)-1-Cyclohexyl-4-(4-(2-methoxyphenyl)piperazin-1-yl)-2-methyl-2-phenylbutan-1-one appears to have no adverse effects on the cardiovascular system.

Mouse monoclonal SPR antibody

Peptide H-EGSDTITLPCRIKQFINMWQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EGSDTITLPCRIKQFINMWQE-OH include the following: Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6 R Menez, M Bossus, BH Muller, G Sibaaca¯ - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/170/4/1917/71076 Distinct signaling cascades elicited by different formyl peptide receptor 2 (FPR2) agonists F Cattaneo, M Parisi, R Ammendola - International journal of molecular , 2013 - mdpi.comhttps://www.mdpi.com/1422-0067/14/4/7193 Formyl peptide receptor-like 1-mediated endogenous TRAIL gene expression with tumoricidal activity C Lin, W Wei, J Zhang, S Liu, Y Liu, D Zheng - Molecular cancer therapeutics, 2007 - AACRhttps://aacrjournals.org/mct/article-abstract/6/10/2618/234861

ARC antibody was raised in Rabbit using Human ARC as the immunogen

5-(1-Methyl-1H-pyrazol-4-yl)-3-[3-(4-pyridinyl)phenyl]-furo[3,2-b]pyridine is a potent and selective inhibitor of the human immunodeficiency virus type 1 integrase. It is used as a research tool to study the role of integrase in HIV infection and for the development of new drugs to treat AIDS. 5-(1-Methyl-1H-pyrazol-4-yl)-3-[3-(4-pyridinyl)phenyl]-furo[3,2-b]pyridine binds to the catalytic site of integrase and prevents integration of viral DNA into host cell DNA. It has been shown to be selectively active against HIV type 1 but not against other retroviruses such as human T lymphotropic virus type 1 or simian immunodeficiency virus.

Purified Polyclonal Amylin antibody

Rabbit polyclonal p53 antibody (FITC)

H-LEKARGSTY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LEKARGSTY-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LEKARGSTY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LEKARGSTY-OH at the technical inquiry form on this page

A human monoclonal antibody targeted against the surface spike protein of SARS-CoV-2 receptor binding domain. Works in combination with tixagevimab and is copackaged.

Rabbit polyclonal CD29 antibody (with azide)

VZV IgG Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about VZV IgG Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Hesperetin 7-O-β-D-glucopyranoside

Region of IL17F protein corresponding to amino acids MRKIPKVGHT FFQKPESCPP VPGGSMKLDI GIINENQRVS MSRNIESRST SPWNYTVTWD PNRYPSEVVQ AQCRNLGCIN AQGKEDISMN SVPIQQETLV VRRKHQGCSV SFQLEKVLVT VGCTCVTPVI HHVQ.

Rabbit polyclonal APP antibody (FITC)

Rabbit polyclonal ALS2CR11 antibody

Please enquire for more information about Amyloid beta-Protein (22-35) including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-LPAYLFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPAYLFT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPAYLFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPAYLFT-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SSX2IP antibody, catalog no. 70R-6039

Borrelia Afzelii p83/100, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Borrelia Afzelii p83/100, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.

Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

RFQ Folate III Antibody Positive Serum/Plasma Pool is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about RFQ Folate III Antibody Positive Serum/Plasma Pool including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Applications 2-Amino-6-methoxybenzothiazole is an intermediate used to prepare novel series of Schiff bases and 4-thiazolidinones. It is also used in the synthesis of 2-cyano-6-methoxybenzothiazole. References Patel, N., et al.: Saudi Pharma. J., 18, 129 (2010); Toya, Y., et al.: Bull. Chem. Soc. Jpn., 65, 392 (1992)

Rabbit polyclonal PACSIN1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LRP2BP antibody, catalog no. 70R-3858

H-IGEDAHILVTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IGEDAHILVTR-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IGEDAHILVTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IGEDAHILVTR-OH at the technical inquiry form on this page

SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12

Peptide H-DSHSLTTNIMEILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSHSLTTNIMEILR^-OH include the following: A circulating extracellular vesicles-based novel screening tool for colorectal cancer revealed by shotgun and data-independent acquisition mass spectrometry X Zheng , K Xu, B Zhou, T Chen - Journal of , 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1080/20013078.2020.1750202 Residual serum fibrinogen as a universal biomarker for all serotypes of Myasthenia gravis FS Hussain, RS Piragasam , H Sarker, D Blackmore - Scientific Reports, 2023 - nature.comhttps://www.nature.com/articles/s41598-023-47559-x

Peptide H-AVDGYVKPQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVDGYVKPQIK-OH include the following: Identification of isoform-specific dynamics in phosphorylation-dependent STAT5 dimerization by quantitative mass spectrometry and mathematical modeling ME Boehm, L Adlung , M Schilling, S Roth - Journal of proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr5006923 Identification of in vivo protein phosphorylation sites with mass spectrometry J Qin, X Zhang - Posttranslational Modifications of Proteins: Tools for , 2002 - Springerhttps://link.springer.com/protocol/10.1385/1-59259-181-7:211 One-source peptide/phosphopeptide standards for accurate phosphorylation degree determination B Hahn, M Böhm, V Raia, N Zinn , P Möller - , 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000569

GENZ 882706 is a racemic mixture of two enantiomers that binds to the GABA receptor and activates it. It has been shown to be an effective inhibitor of GABA-gated currents in cultured hippocampal neurons, and has been used as a research tool for studying the role of GABA receptors in many different biological processes. This compound is also used for studying protein interactions with the GABA receptor.

Recombinant Protein Kinase A regulatory subunit-1 α

Mouse monoclonal HDAC10 antibody

Pyr-Gly-Arg-AMC is a peptide that can be used as a research tool to study the interactions between proteins in the cell. Pyr-Gly-Arg-AMC binds to the receptor site of ion channels and inhibits their function. The high purity of this product means that it is suitable for use in research.

Z-1-Bromoheneicosa-3,6,9,12,15,18-hexaene

Purified Mouse IgG2a FITC conjugate

H-RPAPQQFFGLC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RPAPQQFFGLC-NH2 is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RPAPQQFFGLC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RPAPQQFFGLC-NH2 at the technical inquiry form on this page

Purified recombinant AIG1 protein

Please enquire for more information about ARN 272 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant MFAP3 protein (His tag)

GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Native Human HBsAg protein (Subtype ad)

Peptide H-PFAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PFAV-OH include the following: Mechanisms of persistent infections by cytopathic viruses in tissue culture RM Friedman, JM Ramseur - Archives of Virology, 1979 - Springerhttps://link.springer.com/article/10.1007/BF01348025

SB-737050-A is a solvate of the antipsychotic drug SB-737050. It is used to treat schizophrenia and other psychotic disorders. SB-737050-A is manufactured as an oral tablet, which is designed to dissolve in the stomach. This medicine has been shown to be effective in the treatment of schizophrenia, but it may have side effects such as nausea, vomiting, or constipation.

A synthetic peptide for use as a blocking control in assays to test for specificity of Zfr antibody, catalog no. 70R-8321

This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.

PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A13 antibody, catalog no. 70R-1870

A synthetic peptide for use as a blocking control in assays to test for specificity of SEMG2 antibody, catalog no. 70R-8528

H-AVEPQPPFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AVEPQPPFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AVEPQPPFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AVEPQPPFR-OH at the technical inquiry form on this page

H-SLLCATQGA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLLCATQGA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLLCATQGA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLLCATQGA-OH at the technical inquiry form on this page

PLA2G4B antibody was raised in rabbit using the N terminal of PLA2G4B as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CENPM antibody, catalog no. 70R-2295

Peptide H-LLRSSLILLQGSWF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLRSSLILLQGSWF-NH2 include the following: Seek & Destroy, use of targeting peptides for cancer detection and drug delivery V Le Joncour , P Laakkonen - Bioorganic & medicinal chemistry, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0968089617311094 Synergy between a collagen IV mimetic peptide and a somatotropin-domain derived peptide as angiogenesis and lymphangiogenesis inhibitors JE Koskimaki, E Lee , W Chen , CG Rivera , EV Rosca - Angiogenesis, 2013 - Springerhttps://link.springer.com/article/10.1007/s10456-012-9308-7 Peptide-based cancer therapy: opportunity and challenge D Wu, Y Gao, Y Qi, L Chen, Y Ma, Y Li - Cancer letters, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304383514002572

ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2W1 antibody, catalog no. 70R-10177

The human oligopeptide transporter (PEPT1) is a critical transporter of dipeptides, tripeptides, and peptide-like drugs, including β-lactam and cephalosporin antibiotics, and ACE inhibitors. Therefore, there is an effort to understand better the transport mechanism and substrate requirements of PEPT1 to improve drug uptake.N-L-Glutamyl-L-Lysine is a dipeptide that naturally occurs in the body during protein degradation. It has been used in functional transport assays with other dipeptides to understand PEPT1 binding specificity with substrates and how this affects the conformation. N-L-Glutamyl-L-Lysine, along with other short peptides, is a vital tool in studying facilitator transporters like PEPT1. N-L-Glutamyl-L-Lysine has two charges and forms an intramolecular salt bridge that places the side chains in close proximity to fit the transporter better. N-L-Glutamyl-L-Lysine has helped understand that PEPT1 doesn't bind all dipeptides, and not all bound peptides are transported. Further work with N-L-Glutamyl-L-Lysine could further define the structure&minus-transport relationships of PEPT1 for better drug transportation.

rHuIFN-g

H-DMIDNDQGSSSPS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DMIDNDQGSSSPS-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DMIDNDQGSSSPS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DMIDNDQGSSSPS-OH at the technical inquiry form on this page

Mouse monoclonal TUBA1C antibody

Rabbit polyclonal S1PR5 antibody

Haptoglobin antibody was raised in goat using purified human haptoglobin as the immunogen.

Rabbit polyclonal EGFR antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Eif2c3 antibody, catalog no. 70R-9606

Recombinant Hepatitis C Virus Nucleocapsid (core) 24

Peptide H-SRIAVSYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SRIAVSYQ-OH include the following: Epitope mapping of monoclonal antibodies to tumor necrosis factor-alpha by synthetic peptide approach K Nagahira, Y Fukuda, M Terakawa, J Hashino - Immunology letters, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016524789500031Y

Affinity purified Rabbit polyclonal Olfactory receptor 2A4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SEMG1 antibody, catalog no. 70R-1587

Please enquire for more information about TJ191 including the price, delivery time and more detailed product information at the technical inquiry form on this page

3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyl-2H-tetrazolium bromide

Inauhzin is a drug that acts as an inhibitor of the enzyme methyltransferase, which is involved in the synthesis of DNA. Inauhzin has been shown to inhibit skin cancer in CD-1 mice and may be a potential drug target for this type of cancer. It also inhibits epidermal growth factor receptor (EGFR) in human epidermoid carcinoma cells, leading to cell death by apoptosis. Inauhzin has been found to have no toxicity in mice at doses up to 600 mg/kg. Inauhzin also inhibits monoclonal antibodies and their antibodies, which are involved in the pathogenesis of some cancers.