Produits biochimiques et réactifs

Peptide H-LDLSSLAYSGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LDLSSLAYSGK^^-OH include the following: Quantification of human mature frataxin protein expression in nonhuman primate hearts after gene therapy T Rojsajjakul , JJ Hordeaux , GR Choudhury - Communications , 2023 - nature.comhttps://www.nature.com/articles/s42003-023-05472-z

Pepsin Inhibitor

Anti-PDGF-R α monoclonal antibody; treatment of solid tumors

Ap3b1 antibody was raised in rabbit using the N terminal of Ap3b1 as the immunogen

Serotonin receptor 5-HT2A antagonist

H-SEAGAERQGTLNFPQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SEAGAERQGTLNFPQ-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SEAGAERQGTLNFPQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SEAGAERQGTLNFPQ-OH at the technical inquiry form on this page

BRD4 antibody was raised in rabbit using the C terminal of BRD4 as the immunogen

Mouse monoclonal NOG antibody

Peptide H-EVDMTPADAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EVDMTPADAL-OH include the following: Preferential presentation of herpes simplex virus T-cell antigen by HLA DQA1* 0501/DQB1* 0201 in comparison to HLA DQA1* 0201/DQB1* 0201 DM Koelle , ML Johnson, AN Ekstrom, P Byers - Human immunology, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0198885997000347

HAND2 antibody was raised in mouse using recombinant Human Heart And Neural Crest Derivatives Expressed 2 (Hand2)

NIF3L1 antibody was raised in Rabbit using Human NIF3L1 as the immunogen

Angiopoietin 2 antibody was raised in rabbit using a synthetic peptide corresponding to a region of mouse Angiopietin-2 protein conjugated to KLH as the immunogen.

Affinity purified Rabbit polyclonal Ubiquilin 1 antibody

Purified Polyclonal CLCNKA antibody

Mouse monoclonal GCK antibody

Purified Rabbit polyclonal p53 antibody (Ser20)

A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN1 antibody, catalog no. 70R-1877

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L6 antibody, catalog no. 70R-2779

β-Amyloid 1-15 (Aβ1-15) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and alpha-secretase.Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.

Rabbit polyclonal MKK6 antibody (Ser207)

This antibody is suitable for detecting p-Tau 181, a promising biomarker for the detection and monitoring of Alzheimer's Disease

SULT2B1 antibody was raised using the N terminal of SULT2B1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI

Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.

Peptide H-AIIGLMVGGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AIIGLMVGGVV-OH include the following: Stability of Osaka mutant and wild-type fibril models WM Berhanu , EJ Alred - The journal of physical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b07987 Structures of the Amyloid beta-Peptides Abeta1-40 and Abeta1-42 as Influenced by pH and a d-Peptide OO Olubiyi , B Strodel - The Journal of Physical Chemistry B, 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jp2076337 Assembly and Coassembly of Peptides Derived from beta-Sheet Regions of beta-Amyloid NL Truex - 2017 - escholarship.orghttps://escholarship.org/uc/item/8cw8p99r Liquid chromatography/tandem mass spectrometry characterization of oxidized amyloid beta peptides as potential biomarkers of Alzheimer's disease K Inoue, C Garner, BL Ackermann - in mass spectrometry, 2006 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.2395 The dynamic binding of cholesterol to the multiple sites of C99: as revealed by coarse-grained and all-atom simulations CD Li, Q Xu, RX Gu , J Qu, DQ Wei - Physical Chemistry Chemical , 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/cp/c6cp07873g New Abeta (1-42) ligands from anti-amyloid antibodies: Design, synthesis, and structural interaction A Santoro, M Grimaldi , M Buonocore, I Stillitano - European journal of , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523422003026

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Please enquire for more information about C.I.Solvent Violet 56 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant CHMP5 protein (His tag)

SK2 channel blocker

Rabbit polyclonal GPR173 antibody

Mouse monoclonal ELAVL1 antibody

Mouse monoclonal RPN1 antibody

Peptide H-SMAPGAVHLPQPVSTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SMAPGAVHLPQPVSTR-OH include the following: Diversity in host clone performance within a C hinese hamster ovary cell line PM O'Callaghan, ME Berthelot, RJ Young - Biotechnology , 2015 - Wiley Online Libraryhttps://aiche.onlinelibrary.wiley.com/doi/abs/10.1002/btpr.2097 Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and LJ Huang, JH Lin, JH Tsai, YY Chu , YW Chen - of Chromatography A, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967314016185

Mouse monoclonal FAHD2A antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

4-(Trifluoromethyl)umbelliferyl ?-D-cellotrioside

Lipoamido-dPEG®12-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®12-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.

Rabbit anti-human IgA (biotin) was raised in rabbit using human IgA alpha heavy chain as the immunogen.

2-Methyl-3-(3,5-diiodo-4-carboxymethoxybenzyl)benzofuran is a synthetic benzofuran derivative, which is a compound often used in a range of biochemical applications. This compound is typically sourced through chemical synthesis, involving specific reactions that introduce iodine atoms into the structural configuration of the benzofuran framework. Its mode of action primarily revolves around its interaction with thyroid-related pathways, due to the presence of iodine atoms - an essential element in thyroid hormone synthesis and function. The uses and applications of 2-Methyl-3-(3,5-diiodo-4-carboxymethoxybenzyl)benzofuran are varied, but it is generally studied for its potential role in modulating thyroid activities. It may have implications in thyroid research, particularly in understanding disorders linked to iodine metabolism and regulation. Additionally, its structure suggests potential utility in exploring halogenated compounds’ mechanisms in cellular signaling processes or as a phenolic compound model to study iodine interactions in more complex biological systems.

Purified recombinant Human ECH1 protein

X-Gal

Mouse monoclonal GAP43 antibody

(R)-Zinc-3573 is an antimicrobial peptide that has been expressed in the ganglia of a mouse. The peptide has shown chemotactic activity for eosinophils and vasoactive intestinal peptide-induced contraction of intestinal muscle cells. (R)-Zinc-3573 also inhibits the production of inflammatory mediators, such as chemokines and cortistatin, which are released by activated immune cells. This peptide has also shown inhibitory activities against drug reactions and allergic reactions.