Produits biochimiques et réactifs

Methyltetrazine agarose is a 6% crosslinked agarose resin that is activated with methyltetrazine functional groups for covalent immobilization of TCO-modified biomolecules via a Diels-Alder  reaction. Applications are preparation of protein agarose media with almost quantitative capture of proteins. Activation level: 10-20 µmol methyltetrazine groups per mL resin Bead size: 50-150 µm

A synthetic peptide for use as a blocking control in assays to test for specificity of Utx antibody, catalog no. 70R-7989

ELISA kit for the detection of Parietal Cell in the research laboratory

MS 245 Oxalate is a high purity ligand for research purposes. It is used in Cell Biology to study protein interactions and as an inhibitor in Peptides. MS 245 Oxalate has been shown to activate Ion channels, which may be useful for the treatment of epilepsy.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ44894 antibody, catalog no. 70R-8899

Donkey anti-goat IgG was raised in donkey using goat IgG (H & L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HSF1 antibody, catalog no. 20R-1123

PLA2G3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Coagulation Factor X ELISA kit for the detection of Factor X in the research laboratory

Rabbit Polyclonal JunB antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TTC27 antibody, catalog no. 70R-9467

Purified recombinant PSG1 protein (His tag)

Armenian Hamster monoclonal CCR5 antibody (PE)

EBV VCA and EBNA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV VCA and EBNA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Purified recombinant HES7 protein

HIV1 gp41 antibody was raised in mouse using purified HIV1 envelope gp41 as the immunogen.

H-TVTTSGTTDNTVTPTSQPVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TVTTSGTTDNTVTPTSQPVR-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TVTTSGTTDNTVTPTSQPVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TVTTSGTTDNTVTPTSQPVR-OH at the technical inquiry form on this page

Canine Coronavirus Nucleocapsid Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Canine Coronavirus Nucleocapsid Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Please enquire for more information about MEISi-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDRED

The ME™ Kit is used for specific isolation of extracellular vesicles (exosomes, microvesicles) in as little as 45 minutes using a standard bench top centrifuge. This product is optimized for urine or media samples and contains the 1mg Vn96 peptide (enough for 20x samples), 500µl ME buffer, a negative control (100µg Vn96 scrambled peptide) and 50µl purified exosomes from HEK293 cells as positive control.Extracellular vesicle isolation, is becoming essential in diagnostics and therapeutics. These small membrane-enclosed particles play important roles in many biological processes, including communication, immune response, tissue regeneration, and tumor progression. They are also being studied for their use as biomarkers for various diseases and as potential therapeutics against cancer, neurodegenerative disorders, and inflammatory conditions. It is becoming known that blood profiling alongside exosome analysis provides scientists with suitable resources to monitor disease progression. To combat the challenges associated with exosome isolation Cymit Quimica have developed two ME™ Kits, available for purchase online based on optimization for how different sample types behave: urine or media samples (ME-020) and plasma samples (ME-020P). Our technique produces results comparable to ultracentrifugation, but at much greater efficiency as 1/30th the sample size is required, fulfilling the needs of the diagnostic and pharma industries.   The underlaying mechanisms of how the kit works - an affinity for canonical HSPs - may allow for this to be applied fairly broadly, since HSPs are roundly conserved from bacteria to higher order mammals.For more information on the effectiveness and flexibility of this extracellular isolation technology read our publication (Gosh, 2014).

Mouse monoclonal SLC2A5 antibody

Purified recombinant CXCL5 protein (Mouse) (His tag)

H-GGGVLVQPG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGGVLVQPG-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGGVLVQPG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGGVLVQPG-OH at the technical inquiry form on this page

Rabbit anti-mouse kappa chain (HRP) was raised in rabbit using murine kappa light chain as the immunogen.

Peptide H-TETSQVAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TETSQVAPA-OH include the following: Comprehensive insulin receptor phosphorylation dynamics profiled by mass spectrometry Z Liao, C Zhang, L Ding, JS Moyers, JX Tang - The FEBS , 2022 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.16299 Efficient expression and immunoaffinity purification of human trace amine-associated receptor 5 from E. coli cell-free system X Wang, Y Cui, J Wang - Protein and Peptide Letters, 2013 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2013/00000020/00000004/art00012 T4-Lysozyme Fusion for the Production of Human Formyl Peptide Receptors for Structural Determination X Wang, Y Cui, J Wang - Applied biochemistry and biotechnology, 2014 - Springerhttps://link.springer.com/article/10.1007/s12010-013-0704-2 Production of a bioengineered G-protein coupled receptor of human formyl peptide receptor 3 X Wang, S Zhang - Plos one, 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0023076 Study of two G-protein coupled receptor variants of human trace amine-associated receptor 5 X Wang, K Corin, C Rich, S Zhang - Scientific reports, 2011 - nature.comhttps://www.nature.com/articles/srep00102 Evaluation of cell-free expression system for the production of soluble and functional human GPCR N-formyl peptide receptors X Wang, J Wang , B Ge - Protein and Peptide Letters, 2013 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2013/00000020/00000011/art00012 Structural and functional alterations associated with deutan N94K and R330Q mutations of green cone opsin S Srinivasan , MA Fernandez-Sampedro - et Biophysica Acta (BBA , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0925443917301436 Beyond spectral tuning: human cone visual pigments adopt different transient conformations for chromophore regeneration S Srinivasan , A Cordomaca­ , E Ramon - Cellular and molecular life , 2016 - Springerhttps://link.springer.com/article/10.1007/s00018-015-2043-7 Structural basis for GABAA receptor potentiation by neurosteroids PS Miller , S Scott, S Masiulis, L De Colibus - Nature structural & , 2017 - nature.comhttps://www.nature.com/articles/nsmb.3484 Crystal structure of a human GABAA receptor PS Miller , AR Aricescu - Nature, 2014 - nature.comhttps://www.nature.com/articles/nature13293 Capture and reconstitution of G protein-coupled receptors on a biosensor surface P Stenlund, GJ Babcock, J Sodroski, DG Myszka - Analytical biochemistry, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269703000460 Role of the C terminus of the photoreceptor ABCA4 transporter in protein folding, function, and retinal degenerative diseases M Zhong, LL Molday, RS Molday - Journal of biological chemistry, 2009 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)81778-7/abstract Efficient cell-free production of olfactory receptors: detergent optimization, structure, and ligand binding analyses L Kaiser, J Graveland-Bikker - Proceedings of the , 2008 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0804766105 Glycine-rich transmembrane helix 10 in the staphylococcal tetracycline transporter TetA (K) lines a solvent-accessible channel KA Hassan , KL Robinson, AN Smith, JH Gibson - Biochemistry, 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0614380 # Protein Lights Up in Cryo-EM JZ Chen - Microscopy and Microanalysis, 2019 - cambridge.orghttps://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/protein-lights-up-in-cryoem/EC71BDB367E875252BF04C545DC3DFB7 Constitutive association of cell surface CCR5 and CXCR4 in the presence of CD4 J Wang, R Alvarez , G Roderiquez - Journal of cellular , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jcb.20161 Absolute quantification of the G protein-coupled receptor rhodopsin by LC/MS/MS using proteolysis product peptides and synthetic peptide standards DR Barnidge, EA Dratz , T Martin, LE Bonilla - Analytical , 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac026154+ Improvements in G protein-coupled receptor purification yield light stable rhodopsin crystals D Salom , I Le Trong, E Pohl, JA Ballesteros - Journal of structural , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1047847706001675 Expression of glucagon receptors in tetracycline-inducible HEK293S GnT1-stable cell lines: An approach toward purification of receptor protein for structural studies CG Unson - Peptide Science, 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.20951 Study of a synthetic human olfactory receptor 17-4: expression and purification from an inducible mammalian cell line BL Cook, KE Ernberg, H Chung, S Zhang - PloS one, 2008 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0002920 Large-scale production and study of a synthetic G protein-coupled receptor: human olfactory receptor 17-4 BL Cook, D Steuerwald, L Kaiser - Proceedings of the , 2009 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0811089106 Homogeneous time-resolved fluorescence assay to probe folded G protein-coupled receptors AM Knepp, TP Sakmar , T Huber - Methods in enzymology, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780124078659000108 In vitro reconstitution and preparative purification of complexes between the chemokine receptor CXCR4 and its ligands SDF-1alpha, gp120-CD4 and AMD3100 A Dukkipati , J Vaclavikova, D Waghray - Protein expression and , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592806002270

Purified Turkey IgG FITC conjugate

Mouse monoclonal RASD2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5553

Purified Rabbit polyclonal MBL2 antibody

Peptide H-VRIGHLYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VRIGHLYIL-OH include the following: CRISPR/Cas9 screening reveals a distinct class of MHC-I binders with precise HLA-peptide recognition TAW Schoufour, A van der Plas-van Duijn, I Derksen- iScience, 2024 - cell.comhttps://www.cell.com/iscience/fulltext/S2589-0042(24)01345-2 Characterization and clinical enrichment of HLA-C*07:02-restricted Cytomegalovirus-specific CD8+ T cells F Schlott, D Steubl, S Ameres, A Moosmann, S Dreher- PloS one, 2018 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0193554 Presentation of a conserved adenoviral epitope on HLA-C* 0702 allows evasion of natural killer but not T cell responses A Keib, PS Günther , B Faist, A Halenius- Viral ..., 2017 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2016.0145 Ex vivo screening for immunodominant viral epitopes by quantitative real time polymerase chain reaction (qRT-PCR) M Provenzano , S Mocellin, P Bonginelli- Journal of Translational ..., 2003 - Springerhttps://link.springer.com/article/10.1186/1479-5876-1-12 Clinical and immunological evaluation of patients with metastatic melanoma undergoing immunization with the HLA-Cw* 0702-associated epitope MAGE-A12: 170 MP Bettinotti , MC Panelli, E Ruppe- journal of cancer, 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.11045 Unmasking cryptic epitopes after loss of immunodominant tumor antigens through epitope spreading KM Lally - 2002 - elischolar.library.yale.eduhttps://elischolar.library.yale.edu/cgi/viewcontent.cgi?article=2824&context=ymtdl Unmasking cryptic epitopes after loss of immunodominant tumor antigen expression through epitope spreading KM Lally , S Mocellin, GA Ohnmacht- journal of cancer, 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.1420 Cytolytic T lymphocytes raised against a human bladder carcinoma recognize an antigen encoded by gene MAGE-A12 L Heidecker, F Brasseur, M Probst-Kepper- The Journal of ..., 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/11/6041/32509 A tumor-infiltrating lymphocyte from a melanoma metastasis with decreased expression of melanoma differentiation antigens recognizes MAGE-12 MC Panelli, MP Bettinotti , K Lally - The Journal of ..., 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/8/4382/32607 Cytolytic T Lymphocytes Raised Against a Human Bladder Carcinoma Recognize an Antigen Encoded by Gene... F Brasseur, M Probst-Kepper, TW Boon- 2000 - academia.eduhttps://www.academia.edu/download/51076430/Cytolytic_T_lymphocytes_raised_against_a20161227-11859-128ucll.pdf A Tumor-Infiltrating Lymphocyte from A Recognizes - J Immunol, 2000 - researchgate.nethttps://www.researchgate.net/profile/Francesco-Marincola-2/publication/12562727_A_Tumor-Infiltrating_Lymphocyte_from_a_Melanoma_Metastasis_with_Decreased_Expression_of_Melanoma_Differentiation_Antigens_Recognizes_MAGE-12/links/54487c4b0cf22b3c14e3113f/A-Tumor-Infiltrating-Lymphocyte-from-a-Melanoma-Metastasis-with-Decreased-Expression-of-Melanoma-Differentiation-Antigens-Recognizes-MAGE-12.pdf

Amitifadine is a small molecule that inhibits protein interactions and has been used as a research tool. It has been shown to bind to the extracellular domain of the beta-2 adrenergic receptor, which is responsible for binding with endogenous catecholamines such as epinephrine and norepinephrine. Amitifadine also binds to the alpha-1 adrenergic receptor, but not as strongly. This drug has also been shown to bind to other receptors such as the angiotensin II type 1 receptor, serotonin type 3A receptor, and histamine H1 receptor.

Purified recombinant Human PYCRL protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of GP9 antibody, catalog no. 70R-10332

rHuNOG

Rabbit polyclonal PIH1D1 antibody

H-IAIDLFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAIDLFK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAIDLFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAIDLFK-OH at the technical inquiry form on this page

Mouse monoclonal ACSS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of B3GNT7 antibody, catalog no. 70R-7459

Mouse monoclonal Tenascin antibody

Catalogue peptide; min. 95% purity

This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with Pig ADST. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig ADST. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. The concentration of Pig ADST in the samples is then determined by comparing the OD of the samples to the standard curve.

Hydroxy-PEG12-acid

Treponema Pallidum IgM Positive, EBV IgM Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Treponema Pallidum IgM Positive, EBV IgM Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent Activator

H-LTDIVTLTEEAELEL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LTDIVTLTEEAELEL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LTDIVTLTEEAELEL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LTDIVTLTEEAELEL-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGB1 antibody, catalog no. 70R-6855

Oxanthroquinone G01 is an endoplasmic reticulum protein that is expressed in mammalian cells. It is localized to the endosome and disrupts the epidermal growth factor (EGF)-receptor signaling pathway, leading to cancerous cell growth. Oxanthroquinone G01 has been shown to inhibit the production of inflammatory cytokines, such as IL-1β and IL-6, by downregulating NF-κB activity. This compound also inhibits ectopic expression of EGFR in inflammatory diseases such as psoriasis and rheumatoid arthritis.

Infliximab is a biologic medicine used in the treatment of numerous autoimmune diseases including Crohn disease, rheumatoid arthritis, and ankylosing spondylitis. Infliximab binds with high affinity to tumour necrosis factor-α (TNF-α) blocking most of the cytokine effects, which includes mediating the inflammatory responses. Infliximab is a chimeric human-mouse IgG monoclonal antibody- the constant regions of the heavy and light chains are human-derived. The heavy chain peptide (46-60) has been identified as an antigen for antigen-specific T cell analysis. Numerous methods of immunological analysis can be applied to this peptide to hopefully provide further insight to these autoimmune conditions.

Benzyl 2,3-di-O-benzyl-4,6-O-benzylidene-?-D-glucopyranoside

VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF

BD2 antibody was raised in goat using highly pure recombinant human BD-2 as the immunogen.

G6PDI-1 is a potent, selective, and reversible inhibitor of the enzyme glucose-6-phosphate dehydrogenase. The enzyme is used in glycolysis to produce NADPH. G6PDI-1 has been used as a research tool with applications in cell biology, pharmacology, and protein interactions. This ligand has also been shown to bind to a receptor that regulates ion channel activity.

Tricyclic antidepressants antibody was raised in mouse using Imipramine conjugated to KLH as the immunogen.

Purified Polyclonal BMX antibody

Peptide H-HLSLLTTLSNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HLSLLTTLSNR^-OH include the following: Quantification of total vitamin-D-binding protein and the glycosylated isoforms by liquid chromatography-isotope dilution mass spectrometry LE Kilpatrick, KW Phinney - Journal of Proteome Research, 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00560 USING MASS SPECTROMETRY TO INVESTIGATE PROTEIN BIOMARKERS K Wormwood , AGN Wetie , K Beglinger - Analele Stiintifice ale , 2013 - jemb.bio.uaic.rohttp://www.jemb.bio.uaic.ro/old_pdfs/2013/3/2013F3_01.pdf Measurement of human plasma proteome dynamics with 2H2O and liquid chromatography tandem mass spectrometry JC Price , WE Holmes, KW Li, NA Floreani - Analytical , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269711006038 Vitamin D-binding protein as a biomarker of active disease in acute intermittent porphyria I Serrano-Mendioroz, A Sampedro, MI Mora - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391915300014 Vitamin D-binding protein as a biomarker of active disease in acute intermittent porphyria FJ Corrales , A Fontanellas - 2015 - academia.eduhttps://www.academia.edu/download/53518647/VDBP_AIP_JProt_2015.pdf

MG 624 is a biofungicide, which is derived from naturally occurring microorganisms with a complex enzymatic mode of action. This product employs a consortium of beneficial microbes that produce enzymes capable of degrading the cell walls of various plant pathogens, thus preventing their spread and growth. The primary purpose of MG 624 is to offer an environmentally friendly alternative to chemical fungicides in agricultural settings. By utilizing naturally sourced microorganisms, MG 624 targets specific fungal pathogens without the negative impact on non-target organisms and ecosystems. Its enzymatic action disrupts the structural integrity of pathogen cell walls, leading to their effective elimination. This mode of action not only inhibits existing fungal infections but also provides preventative measures against future outbreaks. Applications of MG 624 span multiple crops and environments where fungal pathogens are prevalent. It can be integrated into comprehensive disease management programs to enhance plant health and yield. This biofungicide is particularly valuable in organic agriculture and integrated pest management (IPM) systems, where sustainable and ecologically responsible solutions are crucial.

Peptide H-KAAFDLSFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KAAFDLSFF-OH include the following: Role of HLA adaptation in HIV evolution HN Kloverpris , A Leslie , P Goulder - Frontiers in immunology, 2016 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2015.00665/full Transmission and accumulation of CTL escape variants drive negative associations between HIV polymorphisms and HLA A Leslie , D Kavanagh, I Honeyborne - The Journal of , 2005 - rupress.orghttps://rupress.org/jem/article-abstract/201/6/891/52735

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

H-NGSNFTSAAFKAACW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NGSNFTSAAFKAACW-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NGSNFTSAAFKAACW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NGSNFTSAAFKAACW-OH at the technical inquiry form on this page

Purified recombinant CCN1 protein (His tag)

Recombinant Human IL12 protein

Rabbit polyclonal BAD antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of POPDC2 antibody, catalog no. 70R-7045

A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-4074

Human sequence expressed in NS0 Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM

A cannabinoid receptor agonist, which binds more selectively to CB2 than CB1 receptors (1000-fold). GW833972A inhibits vagus nerve depolarization induced by tussive agents, such as hypertonic saline (EC50 = 6.5 μM), capsaicin (EC50 = 33.9 μM) or PGE2 (EC50 = 15.9 μM).

Purified recombinant Human Acidic Fibroblast Growth Factor

Recombinant Human c-erbB2

Peptide H-LYAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LYAVR-OH include the following: Insight into trypsin miscleavage: comparison of kinetic constants of problematic peptide sequences T SÌŒlechtová, M Gilar , K Kalikova - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b00866 Studium kinetiky trypsinoveho Å¡tÄ›penaca­ peptidů a chiralnaca­ch separacaca­ biologicky aktivnaca­ch latek metodou HPLC T Å lechtova - 2016 - dspace.cuni.czhttps://dspace.cuni.cz/handle/20.500.11956/83697 Neurotrophin-4: the odd one out in the neurotrophin family CF Ibaaca±ez - Neurochemical research, 1996 - Springerhttps://link.springer.com/article/10.1007/BF02532301

6-Furfurylaminopurine

UGT1A5 antibody was raised in rabbit using the N terminal of UGT1A5 as the immunogen

2,7-Diamino-10-ethyl-9-phenylphenanthridinium bromide, 1% aqueous solution

A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1 antibody, catalog no. 70R-3117

H-LLVVTEGDNATFTCSFSNTS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLVVTEGDNATFTCSFSNTS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLVVTEGDNATFTCSFSNTS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLVVTEGDNATFTCSFSNTS-OH at the technical inquiry form on this page

PF-04418948 is a potent and selective antagonist of the camp receptor. It inhibits the binding of camp to the receptor, thereby inhibiting activation of downstream signaling pathways. PF-04418948 has been shown to inhibit cyclase activity in vitro, which may account for its effects on PGE2 levels. PF-04418948 also prevents cytosolic Ca2+ accumulation by blocking cation channels, which may contribute to its neuroprotective effects. PF-04418948 has been shown to have anti-angiogenic properties in vivo and in vitro experiments. This drug also blocks glutamate release from activated microglia and toll-like receptor signaling pathways, thereby suppressing microbial infection.

Rabbit polyclonal TRIP13 antibody

Celecoxib is a pyrazole derivative that acts as a selective COX-2 inhibitor. It has been shown to inhibit prostaglandin synthesis and promote apoptosis in human osteosarcoma cells. Celecoxib also inhibits tumor growth and inhibits angiogenesis in combination with paclitaxel, which is a chemotherapeutic agent. It is a nonsteroidal anti-inflammatory drug, thus a beneficial treatment in conditions such as rheumatoid arthritis, osteoarthritis, musculoskeletal pain, acute pain and juvenile rheumatoid arthritis. Furthermore it can be utilized in patients with familial adenomatous polyposis to reduce colon and rectal polyps. Celecoxib is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready to use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Inhibitor of COX1 cyclooxygenase

CD3e antibody (PE) was raised in mouse using porcine CD3e as the immunogen.

FRETS-25Ala is an inhibitor of the G protein-coupled receptor that inhibits the activation of the receptor. It is a peptide with a molecular weight of 1206.5 Da and a purity of 99.2%. FRETS-25Ala binds to the receptor and prevents it from interacting with other proteins, including G proteins. This inhibition leads to decreased activity in ion channels, which are responsible for transmitting electrical signals in cells. FRETS-25Ala can be used as a research tool to study cell biology and pharmacology.

m-PEG16-NHS ester

Purified Polyclonal RHCG antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EZH2 antibody, catalog no. 20R-1200

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD2 antibody, catalog no. 70R-8792

Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (135-155) including the price, delivery time and more detailed product information at the technical inquiry form on this page

POLR3C antibody was raised in rabbit using the middle region of POLR3C as the immunogen

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG F(c) fragment as the immunogen.

Affinity purified Rabbit polyclonal CLN2 antibody

The CXCL1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the activity of CXCL1, a protein involved in various biological processes such as inflammation and immune response. This antibody recognizes specific epitopes on CXCL1, allowing for precise targeting and blocking of its function. By binding to CXCL1, this antibody prevents its interaction with receptors and downstream signaling pathways, effectively reducing the inflammatory response. Additionally, it can be used in research applications to study the role of CXCL1 in different cellular processes. The CXCL1 antibody is produced using advanced techniques that ensure high specificity and affinity for its target. It has been extensively validated for use in various experimental setups, including immunohistochemistry, Western blotting, and flow cytometry. Researchers rely on this antibody to gain insights into the functions of CXCL1 and its potential as a therapeutic target. Its use can contribute to advancements in understanding diseases related to inflammation and

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide YY antibody is a calcitonin-like peptide that plays a role in regulating pancreatic insulin secretion. It is an activated and stable analogue of the peptide YY hormone. This antibody has been used in various studies in Life Sciences to investigate its effects on cholinergic and thyrotropin-releasing hormone-induced insulin secretion. Peptide YY antibody has also been utilized in research involving microinjection and subthreshold dose experiments, as well as the use of antisense oligodeoxynucleotides. This polyclonal antibody binds specifically to peptide YY, allowing for the detection and analysis of this hormone in different experimental settings.

STAT5B antibody was raised in rabbit using the N terminal of STAT5B as the immunogen

8-((6-Bromobenzo[D][1,3]dioxol-5-yl)thio)-9-(pent-4-yn-1-yl)-9H-purin-6-amine is a novel small molecule that binds to the extracellular domain of the human α7 nicotinic acetylcholine receptor (nAChR). The binding of this compound to the α7 nAChR is selective and has been shown to be a potent inhibitor of this receptor. It also binds with high affinity and selectivity to the extracellular domain of the human α7 nAChR.

Mouse monoclonal DNAJA2 antibody

m-PEG3-thiol

Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-GQSEVSAAQLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GQSEVSAAQLQER^-OH include the following: Discovery and identification of serum biomarkers for postmenopausal osteoporosis based on TMT labeling and HPLC-MS/MS technology XL Shi, BC Liang, ZY Shi, B Wang, P Wu, LC Kong - Int J Clin Exp , 2017 - e-century.ushttps://e-century.us/files/ijcem/10/1/ijcem0036591.pdf

ELISA kit for the detection of Mouse IL5 in the research laboratory

Mouse monoclonal PDE1B antibody

phi29 Polymerase

Peptide H-CAVIPDSTEQSDVRFSSAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CAVIPDSTEQSDVRFSSAV-OH include the following: Sex and age influence gonadal steroid hormone receptor distributions relative to estrogen receptor beta-containing neurons in the mouse hypothalamic paraventricular NH Contoreggi, S Mazid, LB Goldstein - Journal of , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cne.25093 GPR30: a novel indicator of poor survival for endometrial carcinoma HO Smith, KK Leslie, M Singh, CR Qualls - American journal of , 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002937807000051 G-protein-coupled estrogen receptor 1 is anatomically positioned to modulate synaptic plasticity in the mouse hippocampus EM Waters , LI Thompson , P Patel - Journal of , 2015 - Soc Neurosciencehttps://www.jneurosci.org/content/35/6/2384.short Estrogen-Induced Activation of Erk-1 and Erk-2 Requires the G Protein-Coupled Receptor Homolog, GPR30, and Occurs via Trans-Activation of the Epidermal Growth EJ Filardo , JA Quinn, KI Bland - Molecular , 2000 - academic.oup.comhttps://academic.oup.com/mend/article-abstract/14/10/1649/2751076 Distribution of GPR30, a seven membrane-spanning estrogen receptor, in primary breast cancer and its association with clinicopathologic determinants of tumor EJ Filardo , CT Graeber, JA Quinn, MB Resnick - Clinical cancer , 2006 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/12/21/6359/191061 Activation of the novel estrogen receptor G protein-coupled receptor 30 (GPR30) at the plasma membrane E Filardo , J Quinn, Y Pang, C Graeber, S Shaw - , 2007 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/148/7/3236/2501992 Estrogen receptor alpha and G-protein coupled estrogen receptor 1 are localized to GABAergic neurons in the dorsal striatum A Almey, TA Milner, WG Brake - Neuroscience letters, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304394016302282 Estrogen receptors are found in glia and at extranuclear neuronal sites in the dorsal striatum of female rats: evidence for cholinergic but not dopaminergic A Almey, EJ Filardo , TA Milner, WG Brake - Endocrinology, 2012 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/153/11/5373/2424449 Medial prefrontal cortical estradiol rapidly alters memory system bias in female rats: ultrastructural analysis reveals membrane-associated estrogen receptors as A Almey, E Cannell, K Bertram, E Filardo - , 2014 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/155/11/4422/2422683

A synthetic peptide for use as a blocking control in assays to test for specificity of IRF2BP1 antibody, catalog no. 70R-3119

MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Peptide H-CEEEEYMPME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CEEEEYMPME-OH include the following: Chimeric porcine circoviruses (PCV) containing amino acid epitope tags in the C terminus of the capsid gene are infectious and elicit both anti-epitope tag antibodies NM Beach, SM Smith, S Ramamoorthy - Journal of virology, 2011 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.02294-10 A recombinant porcine circovirus type 2 expressing the VP1 epitope of the type O foot-and-mouth disease virus is infectious and induce both PCV2 and VP1 epitope L Huang, F Zhang, Q Tang, Y Wei, H Wu, L Guo - Applied microbiology , 2014 - Springerhttps://link.springer.com/article/10.1007/s00253-014-5994-y Molecular Tags for Proteins and Their Biological Applications A Basak , S Basak - Current Proteomics, 2018 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cp/2018/00000015/00000005/art00010

N2-(3,4-Dimethylphenyl)-6-((4-(p-tolyl)piperazin-1-yl)methyl)-1,3,5-triazine-2,4-diamine is a potent and selective inhibitor of the voltage gated sodium channel (VGSC). It has been shown to inhibit VGSC with an IC50 value of 3.5 nM on rat brain synaptosomes. N2-(3,4-Dimethylphenyl)-6-((4-(p-tolyl)piperazin-1-yl)methyl)-1,3,5-triazine-2,4-diamine is a novel inhibitor that is structurally distinct from other VGSC inhibitors. It has no affinity for any other protein targets in the proteome.

Rabbit polyclonal TMED3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of UGT2A3 antibody, catalog no. 70R-7441

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Goat anti-monkey IgM (Rhodamine) was raised in goat using monkey IgM mu chain as the immunogen.

BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Purified recombinant Human PIN4 protein

H-GLEIDVTDFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLEIDVTDFK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLEIDVTDFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLEIDVTDFK-OH at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS

Human sequence expressed in E. coli Cells; purity >90% by SDS-PAGE and HPLC.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

2,3:4,5-Di-O-isopropylidene-1-O-propargyl-β-D-fructopyranose

Humanized IgG4 monoclonal antibody targeting TLR2, inflammation prevention

Mouse monoclonal CPA1 antibody

Rabbit polyclonal TOLLIP antibody

MAPKAPK2 antibody was raised in rabbit using the middle region of MAPKAPK2 as the immunogen

Purified recombinant Human PDCD6 protein

This antibody reacts with heavy (gamma) chains on rabbit IgG.

Normal Canine Serum is a metallic component used in various life sciences applications. It contains inhibitors that target tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation and immune response. This serum is rich in amino acid residues and can be used as a control or reference sample in assays involving TNF-α inhibition. Additionally, Normal Canine Serum has been utilized in studies related to adalimumab, pneumococcus, carbonic anhydrase inhibitors, and DNA vaccines. It is commonly employed in veterinary applications for research purposes, particularly in collagen-related studies. This product is available as a biospecimen and can be obtained in the form of serum, plasma, or other fluids. Researchers often rely on Normal Canine Serum to provide valuable insights into various biological processes and veterinary medicine advancements.