Produits biochimiques et réactifs

Purified recombinant CCL3 protein (Mouse) (His tag)

FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY

Oligomycin from Streptomyces diastatochromogenes

BIS-TRIS propane

Mouse monoclonal METTL21A antibody

Region of MDC69 protein corresponding to amino acids GPYGANMEDS VCCRDYVRYR LPLRVVKHFY WTSDSCPRPG VVLLTFRDKE ICADPRVPWV KMILNKLSQ.

Please enquire for more information about 1,3-Dimethyl-8-(2-morpholin-4-ylethylsulfanyl)-6-sulfanylidene-7H-purin-2-one including the price, delivery time and more detailed product information at the technical inquiry form on this page

MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Peptide LCBiot-SWKDASGWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-SWKDASGWS-OH include the following: The respiratory syncytial virus phosphoprotein, matrix protein, and fusion protein carboxy-terminal domain drive efficient filamentous virus-like particle formation CD Meshram , PS Baviskar , CM Ognibene - Journal of , 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01193-16

Rabbit polyclonal ARPC3 antibody (HRP)

5α-Androstan-3α,17β-diol-17β-glucuronide is a metabolite of dihydrotestosterone, which is a type of androgenic steroid. It is primarily sourced from the metabolic pathways involving the action of enzyme systems on testosterone and its derivatives within the body. This compound is formed through the conjugation of 5α-androstanediol with glucuronic acid, a process mediated by the enzyme UDP-glucuronosyltransferase. Its mode of action involves serving as a marker in the assessment of androgen activity and metabolism. As a conjugated steroid, it is excreted in urine and used as an indicator in various physiological and endocrinological studies. It plays a crucial role in understanding androgenic activity, thus contributing valuable insights into disorders related to hormonal imbalances, such as androgenetic alopecia, prostate diseases, and certain endocrine disorders. 5α-Androstan-3α,17β-diol-17β-glucuronide is extensively used in research settings to study androgen metabolism and to develop therapeutic interventions for diseases influenced by androgenic activity. It is instrumental in comprehensively analyzing steroidogenic activity within biological systems, offering applications in both clinical diagnostics and experimental research.

The MAP2 antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). This antibody has been extensively studied in the field of Life Sciences and has shown remarkable efficacy in various research applications. The MAP2 antibody specifically binds to GFAP, which is an intermediate filament protein found predominantly in astrocytes. By targeting GFAP, this antibody enables researchers to study the structure and function of astrocytes, as well as their involvement in various physiological processes. In addition to its role in studying astrocytes, the MAP2 antibody has also been used to investigate the role of GFAP in adipocyte differentiation and activation. Studies have shown that GFAP plays a crucial role in regulating adipocyte function, including fatty acid metabolism and receptor binding. Furthermore, the MAP2 antibody has been shown to be reactive against collagen and other extracellular matrix proteins. This makes it a valuable tool for studying tissue remodeling processes and cell-matrix interactions. Overall, the MAP

114-281 amino acids: MVRERGPQRV AAHITGTRGR SNTLSSPNSK NEKALGRKIN SWESSRSGHS FLSNLHLRNG ELVIHEKGFY YIYSQTYFRF QEEIKENTKN DKQMVQYIYK YTSYPDPILL MKSARNSCWS KDAEYGLYSI YQGGIFELKE NDRIFVSVTN EHLIDMDHEA SFFGAFLVG

NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

SPA4 is a surfactant protein-A (SP-A)-derived peptide which is an antagonist of toll-like receptor-4 (TLR4). SP-A and TLR4 have been identified as important pathogen-pattern recognition receptors (PPRRs). SP-A represents the majority of SPs and plays a key role in fighting pathogens and down-regulating inflammation, whereas TLR4 recognises pathogens and endogenous stress proteins and induces the inflammatory and adaptive immune responses.Over-activation of TLR4 induces inflammatory response via NF-KB and TNF-α cytokine. SPA4 has been shown to bind to TLR4 and inhibit the release of TNF-α in response to the most potent TLR4-ligand: Gram-negative bacteria-derived lipopolysaccharide (LPS), however SPA4 does not interfere with LPS binding to TLR4. The suppression of LPS-TLR4 signalling by SPA4 peptide alleviates inflammatory response.

Peptide H-LREQLGPVTQEFWDNLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LREQLGPVTQEFWDNLEK^-OH include the following: A comparative proteomics analysis of peritoneal dialysate before and after the occurrence of peritonitis episode by mass spectrometry YC Tyan, SB Su , SS Ting, HY Wang, PC Liao - Clinica Chimica Acta, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898112004779 Differentiating vitreous proteomes in proliferative diabetic retinopathy using high-performance liquid chromatography coupled to tandem mass spectrometry H Wang, L Feng, J Hu, C Xie, F Wang - Experimental eye research, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014483512003557 Hereditary hepatic and systemic amyloidosis caused by a new deletion/insertion mutation in the apolipoprotein AI gene. DR Booth , SY Tan, SE Booth - The Journal of , 1996 - Am Soc Clin Investighttps://www.jci.org/articles/view/118725

A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2275