Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules
- Par Biological Target
- Par usage/effets pharmacologiques
- Cryoconservation et composés associés aux cryoconservateurs
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés
- Hormones
- Biologie végétale
- Métabolites secondaires
Produits appartenant à la catégorie "Produits biochimiques et réactifs"
Trier par
Macropin 1
Macropin-1 (MAC-1) is an anti-microbial peptide (AMP) isolated from venom of the solitary bee Macropis fulvipes (Hymenoptera: Melittidae). MAC-1 has activity against both Gram-positive and Gram-negative bacteria, including drug-resistant strains. MAC-1 can inhibit biofilm formation in Staphylococcus aureus and Pseudomonas aeruginosa and also exhibits anti-fungal activity. MAC-1 has little to no haemolytic activity against human cells at microbiologically effective concentrations.Macropin acts by first binding to negatively charged bacterial membrane components- such as peptidoglycan (PTG) or lipopolysaccharide (LPS). Macropin then kills the bacteria by disrupting the outer bacterial membrane and depolarising the cytoplasmic membrane to cause cell penetration.Masse moléculaire :1,416.86 g/mol5-Methyl cromolyn sodium
CAS :5-Methyl cromolyn sodium is a potent inhibitor of the release of histamine and leukotrienes from mast cells and basophils. It is used to prevent allergic reactions because it blocks the activation of these cells. Cromolyn sodium has also been shown to be an effective treatment for asthma, chronic obstructive pulmonary disease (COPD), and other respiratory diseases. 5-Methyl cromolyn sodium has been shown to inhibit ion channels, which may lead to its antihistamine activity. This drug has been shown to bind with high affinity to a number of receptor ligands including peptides, antibodies, and cell biology proteins.Formule :C25H20O11•Na2Degré de pureté :Min. 95%Masse moléculaire :542.4 g/molPcdh11x Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pcdh11x antibody, catalog no. 70R-8668Degré de pureté :Min. 95%H-LAQAYYESTR-OH
Peptide H-LAQAYYESTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LAQAYYESTR-OH include the following: Quantitation of peptides from non-invasive skin tapings using isotope dilution and tandem mass spectrometry N Reisdorph , M Armstrong, R Powell, K Quinn - of Chromatography B, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023217322158(1S)-(-)-β-Pinene, 98%
CAS :This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.Formule :C10H16Degré de pureté :98%Couleur et forme :Clear colorless to light yellow, LiquidMasse moléculaire :136.24α-Tocotrienol
CAS :Formule :C29H44O2Degré de pureté :≥ 98.0%Couleur et forme :Colourless to light-yellow liquidMasse moléculaire :424.7H-KRRRLSSLRASTSKSEC-OH
H-KRRRLSSLRASTSKSEC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRRRLSSLRASTSKSEC-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRRRLSSLRASTSKSEC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRRRLSSLRASTSKSEC-OH at the technical inquiry form on this pageDegré de pureté :Min. 95%9-Epi-cinchonine
CAS :9-Epi-cinchonine is an alkaloid, which is a stereoisomer of cinchonine derived from the bark of cinchona trees. It is primarily used in studies related to stereochemistry and organic synthesis due to its unique molecular configuration. As a stereochemical analog, this compound plays a crucial role in the understanding of chiral interactions and reaction mechanisms. Scientists utilize 9-Epi-cinchonine in research settings to explore its behavior and interactions as it pertains to enantioselectivity and synthesis pathways. This compound's mode of action involves interacting with chiral molecules, allowing researchers to investigate its potential for asymmetric synthesis and chemical resolution processes.Formule :C19H22N2ODegré de pureté :Min. 95%Masse moléculaire :294.4 g/molPF4 protein
Region of PF4 protein corresponding to amino acids EAEEDGDLQC LCVKTTSQVR PRHITSLEVI KAGPHCPTAQ LIATLKNGRK ICLDLQAPLY KKIIKKLLES.Degré de pureté :≥98% By Sds-Page Gel And HplcApelin-36
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C184H297N69O43SMasse moléculaire :4,195.9 g/molAMT antibody
AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVALRRC37B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC37B antibody, catalog no. 70R-6920Degré de pureté :Min. 95%ZNF546 antibody
ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogenDegré de pureté :Min. 95%LLY 283
CAS :SAM-competitive PRMT5 enzyme inhibitorFormule :C17H18N4O4Degré de pureté :Min. 95%Masse moléculaire :342.35 g/mol2,3,4,6-Tetra-O-benzyl-?-D-mannopyranosyl fluoride
CAS :2,3,4,6-Tetra-O-benzyl-?-D-mannopyranosyl fluorideMasse moléculaire :542.64g/molCD154 antibody (FITC)
CD154 antibody (biotin) was raised in mouse using human sgp39 fusion protein as the immunogen.Degré de pureté :Min. 95%
