Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules
- Par Biological Target
- Par usage/effets pharmacologiques
- Cryoconservation et composés associés aux cryoconservateurs
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés
- Hormones
- Biologie végétale
- Métabolites secondaires
Produits appartenant à la catégorie "Produits biochimiques et réactifs"
Trier par
LAPTM4A antibody
LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFAHuman secretory IgA protein
Purified Human secretory IgA proteinDegré de pureté :Tested At A Minimum Of 20 Mg/Ml By Immunoelectrophoresis.C.I.Disperse Red 200
CAS :Please enquire for more information about C.I.Disperse Red 200 including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Vitamin D 1,25(OH)₂ Mouse Monoclonal Antibody
Vitamin D 1,25(OH)₂ Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Vitamin D 1,25(OH)₂ Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.1-Demethylcolchicine
CAS :Please enquire for more information about 1-Demethylcolchicine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H23NO6Degré de pureté :Min. 95%Masse moléculaire :385.4 g/molHBV env (183–191)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C53H92N12O12Masse moléculaire :1,089.4 g/molMLPH antibody
MLPH antibody was raised in rabbit using the C terminal of MLPH as the immunogenDegré de pureté :Min. 95%ZNF174 antibody
ZNF174 antibody was raised in rabbit using the middle region of ZNF174 as the immunogenDegré de pureté :Min. 95%POFUT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POFUT2 antibody, catalog no. 70R-5486ApoC-II antibody
ApoC-II antibody was raised in goat using synthetic, full-length apolipoprotein type C-II as the immunogen.SH3GL2 protein (His tag)
Purified recombinant Human SH3GL2 Protein (His tag)Degré de pureté :Min. 95%MV151
CAS :MV151 is a proteasome inhibitor that has been extensively studied in the field of Life Sciences. It works by preventing the degradation of proteins within cells, leading to their accumulation and eventual cell death. MV151 has been shown to have broad-spectrum activity against various types of cancer cells, making it a promising candidate for cancer treatment. Its mechanism of action involves labelling the target protein with a fluorescent tag, which allows researchers to track its degradation in real-time. This unique feature of MV151 makes it a valuable tool for studying proteasomal function and identifying potential therapeutic targets.Formule :C59H91BF2N8O9SDegré de pureté :Min. 95%Masse moléculaire :1,137.3 g/molSARS-COV-2 S Protein (934 - 947)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,377.53 g/molDihydro-b-erythroidine hydrobromide
CAS :Antagonist of nicotinic receptorFormule :C16H21NO3HBrDegré de pureté :Min. 95%Masse moléculaire :356.25 g/molFirocoxib
CAS :COX-2 enzyme inhibitor; anti-inflammatoryFormule :C17H20O5SDegré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :336.40 g/molFluorescent Brightener 28
CAS :Stability Light Sensitive Applications Fluorescent brightener 28 (CAS# 4193-55-9) is a fluorescent whitening agent used for textiles. References Tang, J.; et al.: Sepu, 36, 670 (2018);Formule :C40H42N12Na2O10S2Couleur et forme :Light YellowMasse moléculaire :960.952-Pyridineacetonitrile
CAS :Produit contrôléApplications 2-Pyridineacetonitrile is a useful reagent for the organic synthesis and studies of pyridyl and dihydropyridyl analogs of meperidine and ketobemidone with their antinociceptive activities. Not a dangerous good if item is equal to or less than 1g/ml and there is less than 100g/ml in the package References Buolamwini, J. K., et al.: Drug Des. Deliv., 7, 19 (1990)Formule :C7H6N2Couleur et forme :NeatMasse moléculaire :118.14
