Produits biochimiques et réactifs

Purified recombinant Human RCL protein

H-Ile-Ser-OH trifluoroacetic acid is a bioactive compound that has been cocrystallized with N,N′-dimethylformamide and analyzed using liquid chromatography/mass spectrometry. It has been shown to be hydrophilic and soluble in water. H-Ile-Ser-OH trifluoroacetic acid has also been detected by mass spectrometric methods as well as electrospray mass spectrometry.

Purified recombinant STEAP4 protein (His tag)

HSV1 antibody (biotin) was raised in goat using HSV type 1, strain F as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFD2 antibody, catalog no. 70R-2438

Rabbit polyclonal TDG antibody

Mouse monoclonal beta Catenin antibody

JNJ-54175446 is a novel antidepressant drug that has a high uptake in the brain. It is an investigational drug that has been shown to have a rapid onset of action and to be effective across multiple depression symptom domains, including mood, anxiety, and cognitive symptoms. JNJ-54175446 binds to the serotonin transporter (SERT) with higher affinity than other antidepressants, which may contribute to its rapid onset of action. The compound also penetrates the blood-brain barrier more easily than other antidepressants and does not show signs of tolerance or withdrawal when used for up to 12 weeks. Clinical studies have shown that JNJ-54175446 has pharmacokinetic properties suitable for once-daily administration. In addition, this drug has been shown to increase levels of brain-derived neurotrophic factor (BDNF) in rats and mice, as well as microglia cells in animal models. This suggests that JNJ-54175446 may have beneficial effects on the brain's microenvironment

Brofluthrinate is a kinase inhibitor that has shown potential as an anti-cancer agent. It has been found to inhibit the growth of human tumor and leukemia cells, including acute myeloid leukemia. Brofluthrinate works by inhibiting the activity of various kinases involved in cell proliferation, angiogenesis, and apoptosis. It also has antibacterial activity against certain strains of bacteria. In endothelial cells, brofluthrinate blocks phosphorylation and activation of proteins involved in angiogenesis, which may contribute to its anti-cancer effects. Overall, brofluthrinate is a promising compound for further investigation as a potential cancer treatment.

PARL antibody was raised in Mouse using a purified recombinant fragment of PARL(aa112-167) expressed in E. coli as the immunogen.

Catalogue peptide; min. 95% purity

WS3 is a heparin-like compound that has been shown to have potent anticoagulant activity and a broad spectrum of activity against bacteria, fungi, and parasites. WS3 is synthesized in the dark by light exposure. The molecular weight of WS3 is approximately 10 kilodaltons (kDa). It has been shown to induce epidermal growth factor production in mammalian cells. WS3 also exhibits high resistance to metabolic profiles, optical sensors, and light emission. This molecule has been shown to be efficient for the treatment of cutaneous lesions caused by fungal biomass.

GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Peptide H-AVAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVAANIVLTV-OH include the following: Islet-reactive CD8+ T cell frequencies in the pancreas, but not in blood, distinguish type 1 diabetic patients from healthy donors S Culina, AI Lalanne, G Afonso, K Cerosaletti - Science , 2018 - science.orghttps://www.science.org/doi/abs/10.1126/sciimmunol.aao4013

Please enquire for more information about AZD3264 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal PPP5C antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF185 antibody, catalog no. 70R-8290

RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE