Produits biochimiques et réactifs

Peptide H-FPEVDVLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FPEVDVLTK-OH include the following: MRM-based quantification of plasma Apolipoprotein AI and B100 to help in identifying coronary-artery disease YL Wong, CY Law, CW Lam - 19th Human Proteome Organization , 2020 - hub.hku.hkhttps://hub.hku.hk/handle/10722/294244 Simultaneous quantification of apolipoprotein AI and apolipoprotein B by liquid-chromatography-multiple-reaction-monitoring mass spectrometry SA Agger, LC Marney , AN Hoofnagle - Clinical chemistry, 2010 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/56/12/1804/5622265 Evaluation of interspecimen trypsin digestion efficiency prior to multiple reaction monitoring-based absolute protein quantification with native protein calibrators I van den Broek, NPM Smit, FP Romijn - Journal of Proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr400763d Quantification of serum apolipoproteins AI and B-100 in clinical samples using an automated SISCAPA-MALDI-TOF-MS workflow I van den Broek, J Nouta, M Razavi, R Yip - Methods, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S104620231500095X Quantifying protein measurands by peptide measurements: where do errors arise? I van den Broek, FP Romijn, NPM Smit - Journal of proteome , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr5011179 Automated multiplex LC-MS/MS assay for quantifying serum apolipoproteins AI, B, CI, C-II, C-III, and E with qualitative apolipoprotein e phenotyping I van den Broek, FP Romijn, J Nouta - Clinical , 2016 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/62/1/188/5611795 Measurement of fractional synthetic rates of multiple protein analytes by triple quadrupole mass spectrometry AYH Lee, NA Yates, M Ichetovkin, E Deyanova - Clinical , 2012 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/58/3/619/5620621 Standardized protocols for quality control of MRM-based plasma proteomic workflows AJ Percy , AG Chambers, DS Smith - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr300893w

Affinity purified Rabbit polyclonal IFN gamma antibody

ELISA Kit for detection of IL13 in the research laboratory

Mouse monoclonal PRL antibody

KLH conjugated linear peptide of C-type lectin domain of Human Surfactant protein A.

Polyethylene Glycol 400 BioChemica

A synthetic peptide for use as a blocking control in assays to test for specificity of GSN antibody, catalog no. 70R-5408

Rabbit polyclonal Cyclin E1 antibody (Thr395), application WB, IHC, ELISA

ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN11 antibody, catalog no. 70R-6144

Rabbit polyclonal SCAMP3 antibody (FITC)

S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.

Propargyl-PEG3-1-O-(b-cyanoethyl-N,N-diisopropyl)phosphoramidite

Tonapofylline is a pharmaceutical preparation that is used to treat glomerular filtration rate problems and hepatic impairment. It is also used for the treatment of pulmonary edema caused by congestive heart failure, myocardial infarction, or cirrhosis. Tonapofylline inhibits the adenosine receptors in the lungs, which blocks the inhibitory effects of adenosine on the airways. This improves lung function and reduces pulmonary edema. Tonapofylline has also been shown to reduce levels of urea nitrogen and creatinine in patients with cirrhosis and cancer. Tonapofylline may also be used for cancer prevention because it lowers the risk of myocardial infarcts in patients with coronary artery disease or congestive heart failure.

GUCY2D antibody was raised in Rabbit using Human GUCY2D as the immunogen

Peptide H-DRVYIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DRVYIHPFHL-OH include the following: Investigation of angiotensin glycosylation by MALDI-TOF and ESI tandem mass spectrometry SJ Park, DH Park , S Sul, SF Oh, IS Park - Bull. Korean Chem , 2004 - researchgate.nethttps://www.researchgate.net/profile/Deok-Hie-Park/publication/264033425_Investigation_of_angiotensin_glycosylation_by_MALDI-TOF_and_ESI_tandem_mass_spectrometry/links/591c0551aca272bf75c86b6d/Investigation-of-angiotensin-glycosylation-by-MALDI-TOF-and-ESI-tandem-mass-spectrometry.pdf Distinct multisite synergistic interactions determine substrate specificities of human chymase and rat chymase-1 for angiotensin II formation and degradation S Sanker , UM Chandrasekharan, D Wilk - Journal of Biological , 1997 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)67399-0/abstract Design of substrate-type ACE inhibitory pentapeptides with an antepenultimate C-terminal proline for efficient release of inhibitory activity S Rao, S Liu, T Ju, W Xu, G Mei, Y Xu - Biochemical engineering , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1369703X11002634 Structure-based design of altered MHC class II-restricted peptide ligands with heterogeneous immunogenicity S Chen, Y Li, FR Depontieu, TL McMiller - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/191/10/5097/86685 Cleavage of arginyl-arginine and lysyl-arginine from the C-terminus ofpro-hormone peptides by human germinal angiotensin I-converting enzyme (ACE) and the C RE ISAAC, AT WILLIAMS , M SAJID - Biochemical , 1997 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/328/2/587/34291 Accurate quantification of impurities in pure peptide material-angiotensin I: Comparison of calibration requirements and method performance characteristics of liquid N Stoppacher, RD Josephs, A Daireaux - Rapid , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.7261 Molecular features influencing the release of peptides from amphiphilic polymeric reverse micelles MAC Serrano, B Zhao , H He , S Thayumanavan - Langmuir, 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.langmuir.7b04065 Lactoferricin-related peptides with inhibitory effects on ACE-dependent vasoconstriction JM Centeno, MC Burguete - Journal of agricultural , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf060482j Structure-Based Design of Altered MHC II Class - 2013 - researchgate.nethttps://www.researchgate.net/profile/Donald-Hunt/publication/257599651_Structure-Based_Design_of_Altered_MHC_Class_II-Restricted_Peptide_Ligands_with_Heterogeneous_Immunogenicity/links/0046352f7d90688dac000000/Structure-Based-Design-of-Altered-MHC-Class-II-Restricted-Peptide-Ligands-with-Heterogeneous-Immunogenicity.pdf Detection of chymase activity using a specific peptide probe conjugated onto gold nanoparticles HF Chang, YL Sun, FY Yeh, IH Tseng, CC Chang - RSC , 2018 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2018/ra/c8ra04322a Acid hydrolysis of proteins in matrix assisted laser desorption ionization matrices E Remily-Wood, H Dirscherl - Journal of the American , 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1016/j.jasms.2009.07.007 Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect DR Brims, J Qian, I Jarchum, L Mikesh - International , 2010 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/22/3/191/792084

Catalogue peptide; min. 95% purity

17a-Estradiol 3 Conjugate for use in immunoassays