Prodotti biochimici e reagenti

Ethomidate is an analog of the anesthetic etomidate that has been found to have anticancer properties. It inhibits the activity of kinases, which are enzymes that regulate cell growth and division. Ethomidate has been shown to induce apoptosis, or programmed cell death, in cancer cells by inhibiting elastase activity. It also inhibits the growth of tumors in mice with human cancer cell xenografts. Ethomidate has potential as a therapeutic agent for the treatment of cancer and may be useful as a kinase inhibitor in other diseases as well. Its effectiveness can be measured through urine analysis and it has shown promising results in preclinical studies.

The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types. This antibody has been extensively tested and validated for its specificity and sensitivity. It shows minimal cross-reactivity with other proteins, ensuring accurate and reliable results. The ASS1 antibody is available in both monoclonal and polyclonal forms, providing options for different experimental needs. In addition to its research applications, the ASS1 antibody has potential therapeutic applications as well. Studies have shown that targeting ASS1 can have anti-tumor effects in certain cancers, making this antibody a promising candidate for cancer therapy. Whether you are conducting research or developing new therapies, the ASS1 antibody is a valuable tool that can help

Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-YGGFLRRI-OH include the following: Lethal factor active-site mutations affect catalytic activity in vitro SE Hammond, PC Hanna - Infection and immunity, 1998 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.66.5.2374-2378.1998 Improved 3D triple resonance experiments, HNN and HN (C) N, for HN and 15N sequential correlations in (13C, 15N) labeled proteins: application to unfolded SC Panchal, NS Bhavesh , RV Hosur - Journal of biomolecular NMR, 2001 - Springerhttps://link.springer.com/article/10.1023/A:1011239023422 In vivo detection of optically-evoked opioid peptide release R Al-Hasani , JMT Wong , OS Mabrouk , JG McCall - Elife, 2018 - elifesciences.orghttps://elifesciences.org/articles/36520 Application of HN (C) N to rapid estimation of 1J (N-Calpha) coupling constants correlated to ψ torsion angles in proteins: implication to structural genomics NS Bhavesh , A Chatterjee, SC Panchal - and biophysical research , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X03020898 Neuroprotective peptides and new strategies for ischemic stroke drug discoveries LV Dergunova, IB Filippenkov, SA Limborska - Genes, 2023 - mdpi.comhttps://www.mdpi.com/2073-4425/14/5/953 Identification of synaptic metabolites of dynorphin A (1-8) by electrospray ionization and tandem mass spectrometry L Prokai , AD Zharikova - Rapid communications in mass , 1998 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0231(19981130)12:22%3C1796::AID-RCM362%3E3.0.CO;2-7 Comparative distribution of neurons containing FLFQPQRFamide-like (morphine-modulating) peptide and related neuropeptides in the rat brain L Kivipelto, P Panula - European Journal of Neuroscience, 1991 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1460-9568.1991.tb00078.x Secondary structure transitions and aggregation induced in dynorphin neuropeptides by the detergent sodium dodecyl sulfate L Hugonin, A Barth, A Graslund - Biochimica et Biophysica , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273608002198 12 Ion Mobility MALDI AS Woods , JA Schultz, SN Jackson - Ion Mobility Spectrometry , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=jodz0-V-lUAC&oi=fnd&pg=PA257&dq=(%22LCBiot-YGGFLRRI-OH%22+OR+%22YGGFLRRI%22)+AND+peptide&ots=3UR3veboqz&sig=9rqwDURLOMBz_dMeZs24_fhv_-s Sulfation, the Up-and-Coming Post-Translational Modification: Its Role and Mechanism in Protein-Protein Interaction AS Woods , HYJ Wang, SN Jackson - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr060529g Dynorphin A (1-8) in human placenta: amino acid sequence determined by tandem mass spectrometry A Agbas , MS Ahmed , W Millington, B Cemerikic - Peptides, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/019697819500013A

Ac-LGAEDGCISTKE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-LGAEDGCISTKE-NH2 is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-LGAEDGCISTKE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-LGAEDGCISTKE-NH2 at the technical inquiry form on this page

NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK

A synthetic peptide for use as a blocking control in assays to test for specificity of NR0B1 antibody, catalog no. 70R-1004

Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a &beta;-ribbon connector region. While E2 is essential for mediating viral attachment, E1&rsquo;s &beta;-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host&rsquo;s membrane. This primarily occurs through the insertion of the DII domain&rsquo;s fusion loop into the host&rsquo;s cell membrane.</p> <p>Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2&rsquo;s A and B domains and E1&rsquo;s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus

Cyclin D1 is a key regulator of cell proliferation and its expression and accumulation within cells is under tight control. Cyclin D1 is the regulatory subunit of cyclin-dependent kinases 4 and 6. These activated cyclin dependent kinases then phosphorylate the retinoblastoma protein (Rb) and drive G1 to S phase progression. Cyclin D1 promotes cell proliferation through interaction with transcription factors such as the oestrogen receptor and specificity protein 1 (Sp1). Cell proliferation is extremely sensitive to altered levels of cyclin D1, with even modest changes in its expression having noticeable effects on cell cycle progression. Cyclin D1 is a proto-oncogene and its overexpression is one of the most frequent alterations seen in multiple cancer types._x000D_ _x000D_ This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.

H-IWGCSGKLICTTNVP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IWGCSGKLICTTNVP-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IWGCSGKLICTTNVP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IWGCSGKLICTTNVP-OH at the technical inquiry form on this page

Rabbit polyclonal HTR1B antibody

Purified recombinant p15, p17, p47 Treponema Pallidum protein

Purified recombinant DCUN1D2 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of FUNDC1 antibody, catalog no. 70R-3364

Purified Polyclonal DOCK11 antibody

Purified Polyclonal Netrin 1 antibody