Biochemicals and Reagents

Rabbit polyclonal AKT1/AKT2/AKT3 antibody

Peptide H-LVVVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LVVVGACGVGK-OH include the following: Global profiling of AMG510 modified proteins identified tumor suppressor KEAP1 as an off-target Y Wang, B Zhong, C Xu, D Zhan , S Zhao, H Wu, M Liu - Iscience, 2023 - cell.comhttps://www.cell.com/iscience/pdf/S2589-0042(23)00157-8.pdf Accelerating the Validation of Endogenous On-Target Engagement and In Cellulo Kinetic Assessment for Covalent Inhibitors of KRASG12C in Early Drug Discovery V Kantae, R Polanski, HJ Lewis, A Haider - ACS Chemical , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.2c00483 Tuning cyclometalated gold (III) for cysteine arylation and ligand-directed bioconjugation S Gukathasan , S Parkin , EP Black - Inorganic , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.inorgchem.1c01517 Quantifying KRAS G12C covalent drug inhibitor activity in mouse tumors using mass spectrometry JC Tran , T Hunsaker, C Bell, TP Ma, E Chan - Analytical , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.2c04417 Comparative microsomal proteomics of a model lung cancer cell line NCI-H23 reveals distinct differences between molecular profiles of 3D and 2D cultured JA Kaczmarczyk , RR Roberts, BT Luke, KC Chan - Oncotarget, 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8487723/ Comparative Microsomal Proteomics of A Model Lung Cancer Cell Line NCI-H23 Reveals Distinct Differences Between Molecular Profiles of 3D and 2D Cultured J Blonder , JA Kaczmarczyk , RR Roberts, BT Luke - 2020 - researchsquare.comhttps://www.researchsquare.com/article/rs-72194/latest SHP2 Inhibition Abrogates Adaptive Resistance to KRASG12C-Inhibition and Remodels the Tumor Microenvironment of KRAS-Mutant Tumors C Fedele , S Li, KW Teng , C Foster , D Peng, H Ran - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.05.30.125138.abstract CRISPR Screening Identifies Mechanisms of Resistance to KRASG12C and SHP2 Inhibitor Combinations in Non-Small Cell Lung Cancer A Prahallad, A Weiss, H Voshol, G Kerr , K Sprouffske - Cancer Research, 2023 - AACRhttps://aacrjournals.org/cancerres/article/doi/10.1158/0008-5472.CAN-23-1127/730017

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2O antibody, catalog no. 70R-3984

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

KLF4 antibody was raised in mouse using recombinant human kLF4 (1-170aa) purified from E. coli as the immunogen.

Cadherin 6 antibody was raised in mouse using GST fusion protein of part of the extracellular domain of cadherin 6 (K-Cadherin) as the immunogen.

Rotavirus antibody (FITC) was raised in goat using nebraska calf diarrhea virus as the immunogen.

Goat anti-cat IgG (biotin) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.

Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.

Rac1 Inhibitor W56 is a small molecule inhibitor, which is a synthetic compound designed to modulate the activity of the Rac1 protein. This inhibitor is derived through chemical synthesis and is characterized by its ability to selectively target Rac1, a member of the Rho family of GTPases. Rac1 plays a crucial role in various cellular processes including cytoskeletal dynamics, gene expression, and cell proliferation. The mode of action of Rac1 Inhibitor W56 involves the direct inhibition of Rac1 activity. By binding to Rac1, the inhibitor prevents its activation and subsequent signal transduction. This blockade results in altered downstream signaling pathways that are dependent on Rac1 activity, thereby affecting processes such as cell migration, growth, and survival. Rac1 Inhibitor W56 is primarily used in research settings to study the role of Rac1 in different cellular mechanisms and pathologies. It is employed in exploring therapeutic strategies for diseases where Rac1 is implicated, such as cancer, cardiovascular diseases, and neurodegenerative disorders. This inhibitor serves as a valuable tool for scientists seeking to unravel the complex biological functions of Rac1 and develop innovative therapeutic interventions.

Purified recombinant Human DECR1 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3GL antibody, catalog no. 70R-10078

Human IgE antibody was raised in mouse using human IgE as the immunogen.

Peptide H-VV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VV-OH include the following: MHC affinity, peptide liberation, T cell repertoire, and immunodominance all contribute to the paucity of MHC class I-restricted peptides recognized by antiviral CTL. Y Deng, JW Yewdell , LC Eisenlohr - Journal of immunology , 1997 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/158/4/1507/30033 Impact of sequence on the molecular assembly of short amyloid peptides VA Wagoner, M Cheon , I Chang - : Structure, Function, and , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prot.24515 Influence of pH on the appearance of active peptides in the course of peptic hydrolysis of bovine haemoglobin V Dubois, N Nedjar-Arroume - Preparative Biochemistry , 2005 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1081/PB-200054693 Peptide prodrugs: improved oral absorption of lopinavir, a HIV protease inhibitor S Agarwal , SHS Boddu , R Jain, S Samanta - International journal of , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517308002172 Analysis of the role of the amino-terminal peptide of vaccinia virus structural protein precursors during proteolytic processing P Lee, DE Hruby - Virology, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682285710690 An NH2-terminal peptide from the vaccinia virus L1R protein directs the myristylation and virion envelope localization of a heterologous fusion protein. MP Ravanello, CA Franke, DE Hruby - Journal of Biological Chemistry, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818532154 Effects of sructure of peptide stationary phases on gas chromatographic separations of amino acid enantiomers JA Corbin, JE Rhoad, LB Rogers - Analytical Chemistry, 1971 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/ac60298a020 Novel peptide-based pepsin inhibitors containing an epoxide group H Ito, T Hirono, Y Morita, Y Nemoto, YT Kim - Journal of Enzyme , 2008 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/14756360701611910

Vacquinol-1

Anti-NGF monoclonal antibody

Rabbit polyclonal FAK antibody (Ser843)

KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL