Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of IBSP antibody, catalog no. 70R-1687

Peptide H-YLAEFATGNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YLAEFATGNDR-OH include the following: Proteomic analysis of human vitreous humor KR Murthy, R Goel , Y Subbannayya , HKC Jacob - Clinical proteomics, 2014 - Springerhttps://link.springer.com/article/10.1186/1559-0275-11-29 Mass spectrometry for comparative proteomics of degenerative and regenerative processes in the brain C Sihlbom - 2006 - gupea.ub.gu.sehttps://gupea.ub.gu.se/handle/2077/774

Peptide H-GKGDPKKPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GKGDPKKPR-OH include the following: Expressing the human HMGB1 gene LJ Li - 2005 - search.proquest.comhttps://search.proquest.com/openview/207a08f4b3b73c80307d1bdedb696b7f/1?pq-origsite=gscholar&cbl=18750&diss=y

G6PDH antibody was raised in rabbit using residues 50-100 of human glucose-6-phosphate dehydrogenase as the immunogen.

Angiotensin converting enzyme (ACE) heavy tryptic peptide standard for use in proteomics studies. ACE is involved in the regulation of blood pressure through converting inactive angiotensin I to active angiotensin II and also degrading active Bradykinin.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Chlormidazole hydrochloride is an inhibitor of protein interactions, activator of protein interactions, and a ligand. It is also used as a research tool in the field of cell biology. Chlormidazole hydrochloride is also a high purity ion channel blocker that has been shown to inhibit the activity of ion channels by binding to specific sites on the external membrane. Chlormidazole hydrochloride binds to receptor proteins on the surface of cells and inhibits their activity. This inhibition may be due to its ability to block ligand-gated channels, which are important for neurotransmitter release in nerve cells. Chlormidazole hydrochloride is also an antibody and can be used as an anti-inflammatory drug or immunosuppressant.

Rabbit polyclonal Hexokinase 3 antibody

PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR

1-138 amino acids: MPNFSGNWKI IRSENFEELL KVLGVNVMLR KIAVAAASKP AVEIKQEGDT FYIKTSTTVR TTEINFKVGE EFEEQTVDGR PCKSLVKWES ENKMVCEQKL LKGEGPKTSW TRELTNDGEL ILTMTADDVV CTRVYVRE

EPS15 antibody was raised using the C terminal of EPS15 corresponding to a region with amino acids LDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNF

A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1B1 antibody, catalog no. 70R-2335

FKBP14 antibody was raised in Rabbit using Human FKBP14 as the immunogen

Myoglobin protein is an essential component of muscle cells and plays a crucial role in oxygen storage and transport. It acts as an antigen, stimulating the production of antibodies in human serum. This protein can be used in various scientific applications, including immunoassays and diagnostic tests. Myoglobin protein can be detected using specific monoclonal antibodies or through the use of enzyme-linked immunosorbent assay (ELISA) kits. It is commonly used in Life Sciences research to study cardiac myosin or adipocyte differentiation. Researchers can also utilize myoglobin protein to investigate autoantibodies or to study the expression of gapdh and phosphatase enzymes. With its diverse applications, myoglobin protein is a valuable tool for scientists working in the field of Proteins and Antigens.

Rabbit anti Goat IgA Secondary Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ODF2 antibody, catalog no. 70R-2636

A synthetic peptide for use as a blocking control in assays to test for specificity of CRYAB antibody, catalog no. 70R-1016

Peptide H-HLWC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HLWC-NH2 include the following: Direct synthesis of ultrafine tetragonal BaTiO3 nanoparticles at room temperature JQ Qi, T Peng, YM Hu, L Sun , Y Wang, WP Chen - Nanoscale research , 2011 - Springerhttps://link.springer.com/article/10.1186/1556-276x-6-466