Produits biochimiques et réactifs

Peptide H-ISFNFFVTAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ISFNFFVTAPK^-OH include the following: Interaction of ACE2 and integrin beta1 in failing human heart Q Lin , RS Keller, B Weaver, LS Zisman - Biochimica et Biophysica Acta , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0925443904000778

Insulin-like growth factor II (IGF2) is a peptide that belongs to the insulin-like growth factors family. It has been shown to activate ion channels and receptors, which are important for cell signaling. IGF2 is also an inhibitor of protein interactions that are involved in signal transduction pathways, such as receptor-ligand interactions and protein-protein interactions. This peptide can be used as a research tool or an antibody.

Rabbit polyclonal Tyrosine Hydroxylase antibody

Aprepitant is a peptide that is an inhibitor of the neurokinin 1 (NK1) receptor. It has been shown to bind to both the free and bound forms of this receptor, inhibiting its activity. Aprepitant is a potent activator of the NK2 receptor, which may be why it also produces strong antiemetic effects. The compound has high purity, with no detectable impurities or aggregates. Aprepitant is used as a research tool in cell biology and pharmacology studies, as well as for the treatment of nausea and vomiting caused by cancer chemotherapy. It binds to the NK1 receptor in the central nervous system, blocking substance P from binding to its receptors on neurons. This prevents substance P from stimulating nerve cells and producing nausea and vomiting.

Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI

Conjugated Phencyclidine-HRP hapten

EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.

The Collagen Type I antibody is a powerful tool for researchers in the Life Sciences field. This monoclonal antibody specifically targets Collagen Type I, a major component of the extracellular matrix. It has been extensively tested and validated for use in various applications. One of the key characteristics of this antibody is its high specificity towards Collagen Type I. It recognizes and binds to this protein with great affinity, allowing for accurate detection and quantification in samples. This makes it an invaluable tool for studying collagen-related processes and diseases. Additionally, the Collagen Type I antibody has been shown to exhibit cytotoxic activity against cells expressing high levels of this protein. This property opens up possibilities for therapeutic applications, particularly in the treatment of collagen-related disorders or cancers. Furthermore, this antibody has been found to inhibit mitogen-activated protein (MAP) kinase signaling pathways. By blocking these pathways, it can modulate cellular responses and provide insights into various biological processes. In summary, the Collagen Type I antibody offers

Purified Rabbit polyclonal WRKY12.1 antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit polyclonal PLCG1 antibody

1-(Phenylsulfonyl)-1H-pyrrolo[2,3-b]pyridine-3-carboxylic acid is a highly specialized chemical compound, utilized primarily in the realm of biochemical and pharmaceutical research. This compound is synthesized through meticulous chemical processes, involving the integration of a phenylsulfonyl group with a pyrrolo-pyridine framework, which contributes to its unique structural properties. The mode of action of 1-(Phenylsulfonyl)-1H-pyrrolo[2,3-b]pyridine-3-carboxylic acid is inherently linked to its structural affinity for certain biological targets, allowing it to inhibit or modulate specific biochemical pathways. This is achieved through its interaction with targeted molecular structures, providing insights into the mechanisms of action for potential therapeutic agents. In terms of applications, this compound is primarily used in the investigation of novel drug candidates, due to its ability to interact selectively with particular protein molecules. Researchers leverage this property to study the inhibition effects and other biochemical interactions within various in vitro systems. Its utilization in drug discovery projects highlights its significance in elucidating the dynamic processes of complex biological systems, thus facilitating the advancement of therapeutic strategies.

Mouse monoclonal GSTM1 antibody

GRM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Peptide H-GGGLGPAGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GGGLGPAGGK-OH include the following: Physiologically Responsive Polyurethanes for Tissue Repair and Regeneration W Liu , S Li, B Wang, P Peng - Advanced NanoBiomed , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/anbr.202200061 Interactions between mesenchymal stem cells, adipocytes, and osteoblasts in a 3D tri-culture model of hyperglycemic conditions in the bone marrow TE Rinker , TM Hammoudi, ML Kemp , H Lu - Integrative , 2014 - academic.oup.comhttps://academic.oup.com/ib/article-abstract/6/3/324/5199138 Development of 3D hydrogel culture systems with on-demand cell separation SK Hamilton , NC Bloodworth , CS Massad - Biotechnology , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/biot.201200200 Poly (ethylene glycol) hydrogels conjugated with a collagenase-sensitive fluorogenic substrate to visualize collagenase activity during three-dimensional cell SH Lee , JJ Moon , JS Miller , JL West - Biomaterials, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961207002232 Three-dimensional micropatterning of bioactive hydrogels via two-photon laser scanning photolithography for guided 3D cell migration SH Lee , JJ Moon , JL West - Biomaterials, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961208002299 Tissue engineered small-diameter vascular grafts RH Schmedlen, WM Elbjeirami - Clinics in plastic , 2003 - plasticsurgery.theclinics.comhttps://www.plasticsurgery.theclinics.com/article/S0094-1298(03)00069-5/abstract Development of hydrogel scaffolds and a bioreactor for vascular tissue engineering RH Schmedlen - 2004 - search.proquest.comhttps://search.proquest.com/openview/c8aac45af4dac321294addb74af3d276/1?pq-origsite=gscholar&cbl=18750&diss=y Advances in the development of supramolecular polymeric biomaterials O Goor, PYW Dankers - Supramolecular Medicinal Chemistry and , 2016 - research.tue.nlhttps://research.tue.nl/en/publications/advances-in-the-development-of-supramolecular-polymeric-biomateri Multiphoton laser fabrication of hybrid photo-activable biomaterials M Bouzin , A Zeynali , M Marini , L Sironi, R Scodellaro - Sensors, 2021 - mdpi.comhttps://www.mdpi.com/1424-8220/21/17/5891 A Modular System to Examine Fibroblastic Differentiation of Mesenchymal Stem Cells Under Tensile Loading in Response to Changes in the Extracellular JS Temenoff - Summer Bioengineering Conference, 2011 - asmedigitalcollection.asme.orghttps://asmedigitalcollection.asme.org/SBC/proceedings-abstract/SBC2011/49/290878 Tissue Engineering Vascular Grafts JP Fisher - Tissue Engineering, 2007 - taylorfrancis.comhttps://www.taylorfrancis.com/chapters/edit/10.1201/9781420008333-33/tissue-engineering-vascular-grafts Tissue Engineered Vascular Grafts JD Bronzino, DR Peterson - Tissue Engineering and Artificial , 2016 - taylorfrancis.comhttps://www.taylorfrancis.com/chapters/edit/10.1201/9781420003871-59/tissue-engineered-vascular-grafts The effects of tensile loading and extracellular environmental cues on fibroblastic differentiation and extracellular matrix production by mesenchymal stem DM Doroski - 2011 - search.proquest.comhttps://search.proquest.com/openview/78f9a708c1d6d353e3d71483d24e5a08/1?pq-origsite=gscholar&cbl=18750 A Dual-Enzyme Amplification Loop for the Sensitive Biosensing of Endopeptidases C Zhou, X Li, SW Tang , C Liu, MHW Lam, YW Lam - ACS omega, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.3c03533 Cell migration through defined, synthetic extracellular matrix analogues AS Gobin , JL West - The FASEB journal, 2002 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fj.01-0759fje Effects of epidermal growth factor on fibroblast migration through biomimetic hydrogels AS Gobin , JL West - Biotechnology progress, 2003 - Wiley Online Libraryhttps://aiche.onlinelibrary.wiley.com/doi/abs/10.1021/bp0341390 Cell migration through biomimetic hydrogel scaffolds AS Gobin - 2003 - search.proquest.comhttps://search.proquest.com/openview/4424a3b19db066a04e47006e7d8f595f/1?pq-origsite=gscholar&cbl=18750&diss=y

Destruxin B from Metarhizium anisopliae

Xanthine

H-WQTSII-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WQTSII-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WQTSII-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WQTSII-OH at the technical inquiry form on this page