Prodotti biochimici e reagenti

PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TFSWASVTSK-OH include the following: The regulation of Toll-like receptor (TLR)-stimulated inducible inhibitory kappa B kinase (IKK-i) expression in murine macrophages G Menagh - 2006 - stax.strath.ac.ukhttp://stax.strath.ac.uk/downloads/nk322d85j

ErbB-2/HER-2/Neu antibody was raised in rabbit using a synthetic peptide derived from C-terminus of human c-erbB-2/HER-2 protein as the immunogen.

Dipeptidylpeptidase IV inhibitor

Azido-PEG6-TFP ester

A synthetic peptide for use as a blocking control in assays to test for specificity of MED31 antibody, catalog no. 70R-4345

POLE4 antibody was raised in rabbit using the N terminal of POLE4 as the immunogen

MGSSHHHHHH SSGLVPRGSH MGKDYYQTLG LARGASDEEI KRAYRRQALR YHPDKNKEPG AEEKFKEIAE AYDVLSDPRK REIFDRYGEE GLKGSGPSGG SGGGANGTSF SYTFHGDPHA MFAEFFGGRN PFDTFFGQRN GEEGMDIDDP FSGFPMGMGG FTNVNFGRSR SAQEPARKKQ DPPVTHDLRV SLEEIYSGCT KKMKISHKRL NPDGKSIRNE DKILTIEVKK GWKEGTKITF PKEGDQTSNN IPADIVFVLK DKPHNIFKRD GSDVIYPARI SLREALCGCT VNVPTLDGRT IPVVFKDVIR PGMRRKVPGE GLPLPKTPEK RGDLIIEFEV IFPERIPQTS RTVLEQVLPI

A synthetic peptide for use as a blocking control in assays to test for specificity of RHBDF1 antibody, catalog no. 70R-6632

VIT-2763 is a peptide that is used in research as an activator of ion channels and receptor. It has been shown to be an inhibitor of protein interactions and can bind to the ligand or receptor. VIT-2763 is a high purity product with a CAS number of 2095668-10-1.

Peptide H-VMAPRTLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VMAPRTLL^-OH include the following: The role of uterine natural killer cell-inhibition in pregnancy N Shreeve - 2021 - repository.cam.ac.ukhttps://www.repository.cam.ac.uk/items/8dfa137f-1efd-4b84-884d-544dc8ca719d SIV-induced terminally differentiated adaptive NK cells in lymph nodes associated with enhanced MHC-E restricted activity N Huot , P Rascle, C Petitdemange, V Contreras - Nature , 2021 - nature.comhttps://www.nature.com/articles/s41467-021-21402-1 Non-classical MHC class I molecules on intestinal epithelial cells: mediators of mucosal crosstalk L Shao, O Kamalu, L Mayer - Immunological reviews, 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.0105-2896.2005.00295.x Natural killer cell receptor NKG2A/HLA-E interaction dependent differential thymopoiesis of hematopoietic progenitor cells influences the outcome of HIV EJ Yunis, V Romero, F Diaz-Giffero, J Zuaca±iga - Journal of stem , 2007 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC2581831/

IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen

Tacrolimus is a calcineurin inhibitor drug that is used for the prevention of rejection after an organ transplant. This drug can also be used in the treatment of severe atopic dermatitis. Tacrolimus’ mechanism of action is not well known however it is understood that this drug inhibits T-lymphocyte activation by binding to an intracellular protein called FKBP-12. This drug also has anti-inflammatory properties. Tacrolimus monohydrate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Affinity purified Rabbit polyclonal Lewis A antibody

Peptide H-YAASSYLSLTPEQWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YAASSYLSLTPEQWK-OH include the following: A novel approach for the purification and proteomic analysis of pathogenic immunoglobulin free light chains from serum F Lavatelli , F Brambilla , V Valentini, P Rognoni - et Biophysica Acta (BBA , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157096391000333X Identification and characterization of an IgG sequence variant with an 11 kDa heavy chain C-terminal extension using a combination of mass spectrometry and high C Harris , W Xu, L Grassi , C Wang, A Markle - MAbs, 2019 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2019.1667740

Expressed in E.coli and lyophilised from 20mM Sodium Carbonate buffer at pH 9.6, this full length recombinant HIV-1 group O gp41 antigen is one of two key envelope glycoproteins facilitating the entry of the Human Immunodeficiency Virus (HIV) into CD4 T cells. While the second envelope protein gp120 (FH108439) binds to cell surface receptors on the target cell, the gp41 demonstrates fusogenic properties whereby the refolding of its N-terminal and C-terminal heptad repeat regions into a six-helix bundle, enables the virus to fuse and gain entry into the T cell. These heptad regions are potential points of interest as inhibitor targets and their peptide derivatives which can competitively block the six-helix bundle formation can be used in combination therapy treatment for HIV. Another segment of the gp41 protein crucial to viral fusion and therapeutic use in vaccines, is the tryptophan-rich Membrane Proximal External Region (MPER). This contains exposed epitopes which can be targeted by broadly neutralising antibodies (bNAbs). The gp41 protein has further assay applications in antibody and antigen detecting assays: ELISA, western blot and lateral flow. In particular it can determine the type of infection to be a HIV-1 group M, O or HIV-2 virus when used in an ELISA assay.

Rabbit polyclonal CD171 antibody (Ser1181)