Produits biochimiques et réactifs

Catalogue peptide; min. 95% purity

A potent Met kinase inhibitor (IC50 = 3.9 nM). Also inhibits Axl, Ron, and Tyro-3 (IC50 = 1.1, 1.8 and 4.3 nM, respectively). Anti-proliferative in Met-driven tumors in vitro and in vivo. Induces polyploidy in breast cancer cells and thereby chemoresistance.

Thrombomodulin protein is a crucial component in the regulation of blood clotting. It acts as a cofactor for thrombin, an enzyme involved in the conversion of fibrinogen to fibrin, which forms blood clots. Thrombomodulin protein also has anti-inflammatory properties and plays a role in endothelial cell growth and angiogenesis. Our recombinant Thrombomodulin protein is produced using advanced biotechnology techniques, ensuring high purity and activity. It is available in both monoclonal antibody form and activated form, providing versatility for various research applications. Studies have shown that Thrombomodulin protein can be used to assess microvessel density, making it valuable in life sciences research focused on angiogenesis and tumor growth. Additionally, it has been found to interact with other proteins such as glucagon, adrenomedullin, and fibrinogen, suggesting potential therapeutic applications as inhibitors or modulators of these pathways. With its wide

Peptide H-ITDQVPFSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ITDQVPFSV-OH include the following: Functional characterization of CTL against gp100 altered peptide ligands SO Dionne, MH Smith, FM Marincola - Cancer Immunology , 2003 - Springerhttps://link.springer.com/article/10.1007/s00262-002-0358-3 Antigen presentation of a modified tumor-derived peptide by tumor infiltrating lymphocytes SO Dionne, MH Smith, FM Marincola, DF Lake - Cellular immunology, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0008874901918933 Induction of circulating tumor-reactive CD8+ T cells after vaccination of melanoma patients with the gp100209-2M peptide SL Meijer, A Dols, SM Jensen, HM Hu - Journal of , 2007 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2007/07000/Adoptive_Cellular_Therapy_With_Tumor_Vaccine.00008.aspx Increased immunogenicity of an anchor-modified tumor-associated antigen is due to the enhanced stability of the peptide/MHC complex: implications for vaccine OY Borbulevych , TK Baxter, Z Yu - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/174/8/4812/1745 An HLA-A2 polyepitope vaccine for melanoma immunotherapy L Mateo, J Gardner, Q Chen, C Schmidt - The Journal of , 1999 - journals.aai.orghttps://journals.aai.org/jimmunol/article/163/7/4058/105313 Recombinant Virus Vaccination against"Self" Antigens UsingAnchor-fixed Immunogens KR Irvine, MR Parkhurst, EP Shulman, JP Tupesis - Cancer research, 1999 - AACRhttps://aacrjournals.org/cancerres/article-abstract/59/11/2536/505166 Destructive cleavage of antigenic peptides either by the immunoproteasome or by the standard proteasome results in differential antigen presentation J Chapiro, S Claverol, F Piette, W Ma - The Journal of , 2006 - journals.aai.orghttps://journals.aai.org/jimmunol/article/176/2/1053/73604 Peptide-specific CD8+ T-cell evolution in vivo: Response to peptide vaccination with Melan-A/MART-1 E Jager, H Höhn, A Necker, R Förster - journal of cancer, 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.10165 Phenotypic and functional maturation of tumor antigen-reactive CD8+ T lymphocytes in patients undergoing multiple course peptide vaccination DJ Powell Jr, SA Rosenberg - Journal of immunotherapy, 2004 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2004/01000/Long_Term_Survival_of_Anti_Tumor_Lymphocytes.4.aspx Immunogenicity for CD8+ and CD4+ T cells of 2 formulations of an incomplete freund's adjuvant for multipeptide melanoma vaccines CL Slingluff , GR Petroni , ME Smolkin - Journal of , 2010 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2010/07000/immunogenicity_for_cd8__and_cd4__t_cells_of_2.8.aspx Generation of melanoma-specific cytotoxic T lymphocytes for allogeneic immunotherapy A Nolte, C Scheffold, J Slotty, C Huenefeld - Journal of , 2003 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2003/05000/Response_Rates_of_Patients_With_Metastatic.9.aspx

Peptide Ac-Rpt-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-Rpt-NH2 include the following: Lysophospholipid-containing membranes modulate the fibril formation of the repeat domain of a human functional amyloid, pmel17 Z Jiang , JC Lee - Journal of molecular biology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283614005348 ATP binding by proteasomal ATPases regulates cellular assembly and substrate-induced functions of the 26 S proteasome YC Kim, X Li, D Thompson, GN DeMartino - Journal of Biological Chemistry, 2013 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)46448-8/abstract C termini of proteasomal ATPases play nonequivalent roles in cellular assembly of mammalian 26 S proteasome YC Kim, GN DeMartino - Journal of Biological Chemistry, 2011 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)48486-X/abstract N-Terminal methylation of proteasome subunit R pt1 in yeast Y Kimura, Y Kurata, A Ishikawa, A Okayama - , 2013 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201300207 Variably modulated gating of the 26S proteasome by ATP and polyubiquitin X Li, GN DeMartino - Biochemical Journal, 2009 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/421/3/397/44648 Proteasome activation is mediated via a functional switch of the Rpt6 C-terminal tail following chaperone-dependent assembly V Sokolova , F Li, G Polovin, S Park - Scientific reports, 2015 - nature.comhttps://www.nature.com/articles/srep14909 Differential roles of the COOH termini of AAA subunits of PA700 (19 S regulator) in asymmetric assembly and activation of the 26 S proteasome TG Gillette , B Kumar, D Thompson - Journal of biological , 2008 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)56926-3/abstract N-terminal coiled-coil structure of ATPase subunits of 26S proteasome is crucial for proteasome function T Inobe , R Genmei - Plos one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0134056 Inhibition of the 26S proteasome by peptide mimics of the coiled-coil region of its ATPase subunits T Inobe , R Genmei - Biochemical and Biophysical Research , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X1530841X Evidence for atrial natriuretic factor induced natriuretic peptide receptor subtype switching in rat proximal tubular cells during culture SK Mistry, PK Chatterjee , RP Weerackody - Experimental , 1998 - karger.comhttps://karger.com/nee/article/6/2/104/830173 Stable incorporation of ATPase subunits into 19 S regulatory particle of human proteasome requires nucleotide binding and C-terminal tails SH Lee, JH Moon, SK Yoon, JB Yoon - Journal of Biological Chemistry, 2012 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)60886-9/abstract Supplementary Figures, Tables, Methods, and Discussion for S Park, X Li, HM Kim, CR Singh , G Tian, MA Hoyt - researchgate.nethttps://www.researchgate.net/profile/Philip-Coffino/publication/294904934_Supplementary_Material/links/56f11c7208aecad0f31f22c9/Supplementary-Material.pdf Reconfiguration of the proteasome during chaperone-mediated assembly S Park, X Li, HM Kim , CR Singh , G Tian, MA Hoyt - Nature, 2013 - nature.comhttps://www.nature.com/articles/nature12123 The expression and secretion of atrial natriuretic factor and brain natriuretic peptide by rat proximal tubular cells S Mistry, B Lussert, K Stewart, GM Hawksworth - Biochemical , 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006295299003792 Differential expression of natriuretic peptide receptors in primary cultures of rat and human proximal tubular cells: a role for the natriuretic peptides S Mistry - 1998 - search.proquest.comhttps://search.proquest.com/openview/77673bd6fbb9b27370094fd75e73e8a6/1?pq-origsite=gscholar&cbl=51922&diss=y Peptides as Vectors for Radiopharmaceutical Therapy RA Davis, T Ganguly, SH Hausner - Radiopharmaceutical , 2023 - Springerhttps://link.springer.com/chapter/10.1007/978-3-031-39005-0_13 Reconstitution of the 26S proteasome reveals functional asymmetries in its AAA+ unfoldase R Beckwith, E Estrin, EJ Worden , A Martin - Nature structural & , 2013 - nature.comhttps://www.nature.com/articles/nsmb.2659 New peptide-based pharmacophore activates 20S proteasome PA Osmulski , P Karpowicz , E Jankowska , J Bohmann - Molecules, 2020 - mdpi.comhttps://www.mdpi.com/1420-3049/25/6/1439 Identification of an amyloid fibril forming segment of human Pmel17 repeat domain (RPT domain) NN Louros , VA Iconomidou - Peptide Science, 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.22746 Peptides and peptidomimetics in medicine, surgery and biotechnology L Gentilucci , A Tolomelli - Current medicinal , 2006 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cmc/2006/00000013/00000020/art00007 Reconfiguration of the proteasome during chaperone-mediated assembly KP Battaile, M Zolkiewski, P Coffino, J Roelofs - 2013 - academia.eduhttps://www.academia.edu/download/74300028/Reconfiguration_of_the_proteasome_during20211107-12015-7nsw7w.pdf Rpt5-Derived Analogs Stimulate Human Proteasome Activity in Cells and Degrade Proteins Forming Toxic Aggregates in Age-Related Diseases K CekaÅ‚a, K Trepczyk, J Witkowska - International Journal of , 2024 - mdpi.comhttps://www.mdpi.com/1422-0067/25/9/4663 Conformational analysis of cyclic hexapeptides designed as constrained ligands for the SH2 domain of the p85 subunit of phosphatidylinositol-3-OH kinase JJ Barchi Jr, M Nomizu, A Otaka , PP Roller - , 1996 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-0282(199602)38:2%3C191::AID-BIP6%3E3.0.CO;2-Q Co-and post-translational modifications of the 26S proteasome in yeast J Kikuchi, Y Iwafune, T Akiyama, A Okayama - , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200900283 Production and Characterization of Monoclonal Antibodies Directed against the Ah Receptor GH PERDEW , B Abbott, LH Stanker - Hybridoma, 1995 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/hyb.1995.14.279 Novel peptide binder to Glypican-3 for targeted radiopharmaceutical therapy of hepatocellular carcinoma. G Li, F Lin, R Clift, T Ehara, H Yanagida, S Horton - 2023 - ascopubs.orghttps://ascopubs.org/doi/abs/10.1200/JCO.2023.41.16_suppl.e16131 Purification and characterization of an amyloidogenic repeat domain from the functional amyloid Pmel17 DN Dean , JC Lee - Protein expression and purification, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592821001273 Modulating functional amyloid formation via alternative splicing of the premelanosomal protein PMEL17 DN Dean , JC Lee - Journal of Biological Chemistry, 2020 - ASBMBhttps://www.jbc.org/article/S0021-9258(17)50283-5/abstract Conserved prolines in the coiled coil-OB domain linkers of proteasomal ATPases facilitate eukaryotic proteasome base assembly CL Cheng, MK Wong, Y Li, M Hochstrasser - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.11.13.381962.abstract Thiostrepton interacts covalently with Rpt subunits of the 19S proteasome and proteasome substrates C Sandu, N Chandramouli, JF Glickman - Journal of cellular , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/jcmm.12602 The C terminus of Rpt3, an ATPase subunit of PA700 (19 S) regulatory complex, is essential for 26 S proteasome assembly but not for activation B Kumar, YC Kim, GN DeMartino - Journal of biological chemistry, 2010 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)60648-2/abstract The substrate translocation channel of the proteasome A Köhler, M Bajorek, M Groll , L Moroder, DM Rubin - Biochimie, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0300908401012421

Please enquire for more information about 2-Bromo-6-methoxy-2-propionaphthone including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ac-CSRVTHPHLPRALMR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSRVTHPHLPRALMR-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSRVTHPHLPRALMR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSRVTHPHLPRALMR-NH2 at the technical inquiry form on this page

Purified recombinant Human RAB1B protein

Glucagon-like peptide 2 (GLP-2) is a protein hormone that belongs to the glucagon family of peptides. GLP-2 has been shown to activate ion channels and regulate the movement of ions across cell membranes, which is important for many physiological processes. GLP-2 also has an inhibitory effect on the release of insulin from beta cells in pancreatic islets. It has been shown to improve glucose tolerance in animal models of Type 2 diabetes by stimulating the production and secretion of insulin from beta cells in pancreatic islets. Additionally, GLP-2 can bind to a receptor on the surface of certain types of immune cells called T lymphocytes and stimulate them to produce cytokines that promote growth and development of other immune cells. Glucagon-like Peptide 2 (Human) is a research tool used in studies involving protein interactions, ligand binding, pharmacology, cell biology, or antibody production. This product is highly purified with a purity

P21Cip1 is a recombinant protein that is tagged with GST. P21Cip1 is a member of the cyclin-dependent kinase inhibitor family and binds to the retinoblastoma protein, thereby inhibiting its activity. P21Cip1 has been used as a research tool for studying cell biology, ion channels, and peptides. It also can be used in antibody production to inhibit protein interactions.

[Dap3]-Ghrelin (Rat) is an analog of the peptide hormone Ghrelin and is a growth-hormone releasing peptide. Ghrelin has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases.

Mouse monoclonal BAIAP2 antibody

PF-06745268 is a peptide that inhibits the activity of a protein called GPR17. PF-06745268 binds to the receptor and blocks it from binding to its ligand, which prevents the ligand from activating the receptor. This can be used as a research tool for studying GPR17 and other receptors. PF-06745268 has been shown to bind to cell membranes in high purity and has no detectable cytotoxicity.

Peptide H-NIYLNSGLTSTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NIYLNSGLTSTK-OH include the following: Matrix Metalloproteinase-14 as an Instigator of Fibrosis in Human Pterygium and Its Pharmacological Intervention C Masitas, Z Peng , M Wang, MM Konai - ACS Pharmacology & , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsptsci.2c00125

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool